Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.3kD).)

Mouse anti-Human Kallikrein 4 Monoclonal Antibody | anti-KLK4 antibody

Kallikrein 4 (Kallikrein-4, Enamel Matrix Serine Proteinase 1, Kallikrein-like Protein 1, KLK-L1, Prostase, Serine Protease 17, EMSP1, PRSS17, PSTS) (FITC)

Gene Names
KLK4; ARM1; EMSP; PSTS; AI2A1; EMSP1; KLK-L1; PRSS17; kallikrein
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Kallikrein 4; Monoclonal Antibody; Kallikrein 4 (Kallikrein-4; Enamel Matrix Serine Proteinase 1; Kallikrein-like Protein 1; KLK-L1; Prostase; Serine Protease 17; EMSP1; PRSS17; PSTS) (FITC); anti-KLK4 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2A4
Specificity
Recognizes human KLK4.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Sequence Length
1347
Applicable Applications for anti-KLK4 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa159-254 from KLK4 (NP_004908) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
GRMPTVLQCVNVSVVSEEVCSKLYDPLYHPSMFCAGGGQDQKDSCNGDSGGPLICNGYLQGLVSFGKAPCGQVGVPGVYTNLCKFTEWIEKTVQAS
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.3kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.3kD).)

Western Blot (WB)

(Western Blot analysis of KLK4 expression in transfected 293T cell line by KLK4 monoclonal antibody Lane 1: KLK4 transfected lysate (Predicted MW: 27kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of KLK4 expression in transfected 293T cell line by KLK4 monoclonal antibody Lane 1: KLK4 transfected lysate (Predicted MW: 27kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged KLK4 is 3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged KLK4 is 3ng/ml as a capture antibody.)
Related Product Information for anti-KLK4 antibody
Kallikreins are a subgroup of serine proteases and are implicated in carcinogenesis. A novel Kallikrein gene Prostase/KLK-L1 (also known as KLK4) is expressed and is up-regulated by androgens and progestins. KLK-L1 may be involved in the pathogenesis and/or progression of prostate, breast, and possibly other malignancies.
Product Categories/Family for anti-KLK4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens kallikrein related peptidase 4 (KLK4), transcript variant 1, mRNA
NCBI Official Synonym Full Names
kallikrein related peptidase 4
NCBI Official Symbol
KLK4
NCBI Official Synonym Symbols
ARM1; EMSP; PSTS; AI2A1; EMSP1; KLK-L1; PRSS17; kallikrein
NCBI Protein Information
kallikrein-4
UniProt Protein Name
Kallikrein-4
Protein Family
UniProt Gene Name
KLK4
UniProt Synonym Gene Names
EMSP1; PRSS17; PSTS; KLK-L1
UniProt Entry Name
KLK4_HUMAN

NCBI Description

Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one of the fifteen kallikrein subfamily members located in a cluster on chromosome 19. In some tissues its expression is hormonally regulated. The expression pattern of a similar mouse protein in murine developing teeth supports a role for the protein in the degradation of enamel proteins. Several transcript variants encoding different proteins have been found for this gene. [provided by RefSeq, Dec 2014]

Uniprot Description

KLK4: Involved in enamel formation. Defects in KLK4 are the cause of amelogenesis imperfecta hypomaturation type 2A1 (AI2A1). AI2A1 is an autosomal recessive defect of enamel formation. The disorder involves both primary and secondary dentitions. The teeth have a shiny agar jelly appearance and the enamel is softer than normal. Brown pigment is present in middle layers of enamel. Belongs to the peptidase S1 family. Kallikrein subfamily.

Protein type: EC 3.4.21.-; Protease; Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 19q13.41

Cellular Component: extracellular region

Molecular Function: serine-type peptidase activity; serine-type endopeptidase activity; metal ion binding

Biological Process: extracellular matrix disassembly; protein catabolic process; proteolysis

Disease: Amelogenesis Imperfecta, Hypomaturation Type, Iia1

Research Articles on KLK4

Similar Products

Product Notes

The KLK4 klk4 (Catalog #AAA6147860) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Kallikrein 4 (Kallikrein-4, Enamel Matrix Serine Proteinase 1, Kallikrein-like Protein 1, KLK-L1, Prostase, Serine Protease 17, EMSP1, PRSS17, PSTS) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Kallikrein 4 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the KLK4 klk4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Kallikrein 4, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.