Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged JTV1 is 0.03 ng/ml as a capture antibody.)

Mouse JTV1 Monoclonal Antibody | anti-JTV1 antibody

JTV1 (JTV1 Gene, AIMP2, P38, PRO0992) (PE)

Gene Names
AIMP2; P38; JTV1; JTV-1; PRO0992
Applications
Western Blot
Purity
Purified
Synonyms
JTV1; Monoclonal Antibody; JTV1 (JTV1 Gene; AIMP2; P38; PRO0992) (PE); JTV1 Gene; PRO0992; anti-JTV1 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
80000000
Specificity
Recognizes JTV1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-JTV1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
JTV1 (NP_006294.2, 1aa-100aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MPMYQVKPYHGGGAPLRVELPTCMYRLPNVHGRSYGPAPGAGHVQEESNLSLQALESRQDDILKRLYELKAAVDGLSKMIQTPDADLDVTNIIQADEPTT
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged JTV1 is 0.03 ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged JTV1 is 0.03 ng/ml as a capture antibody.)

Western Blot (WB)

(JTV1 monoclonal antibody (M02), clone 8E7. Western Blot analysis of JTV1 expression in K-562.)

Western Blot (WB) (JTV1 monoclonal antibody (M02), clone 8E7. Western Blot analysis of JTV1 expression in K-562.)
Related Product Information for anti-JTV1 antibody
The JTV1 gene is located on chromosome 7p22 flanked by two genes, HRI and PMS2. JTV1 and HRI overlap slightly and are arranged in a tail-to-tail fashion. JTV1 and PMS2 are separated by approximately 200 base pairs and are arranged head-to-head. JTV1 is transcribed in the opposite direction compared to HRI and PMS2. The function of the JTV1 gene product is unknown. [provided by RefSeq]
Product Categories/Family for anti-JTV1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35,349 Da
NCBI Official Full Name
aminoacyl tRNA synthase complex-interacting multifunctional protein 2
NCBI Official Synonym Full Names
aminoacyl tRNA synthetase complex-interacting multifunctional protein 2
NCBI Official Symbol
AIMP2
NCBI Official Synonym Symbols
P38; JTV1; JTV-1; PRO0992
NCBI Protein Information
aminoacyl tRNA synthase complex-interacting multifunctional protein 2
UniProt Protein Name
Aminoacyl tRNA synthase complex-interacting multifunctional protein 2
UniProt Gene Name
AIMP2
UniProt Synonym Gene Names
JTV1
UniProt Entry Name
AIMP2_HUMAN

NCBI Description

The JTV1 gene is located on chromosome 7p22 flanked by two genes, HRI and PMS2. JTV1 and HRI overlap slightly and are arranged in a tail-to-tail fashion. JTV1 and PMS2 are separated by approximately 200 base pairs and are arranged head-to-head. JTV1 is transcribed in the opposite direction compared to HRI and PMS2. The function of the JTV1 gene product is unknown. [provided by RefSeq, Jul 2008]

Uniprot Description

JTV1: Required for assembly and stability of the aminoacyl- tRNA synthase complex. Mediates ubiquitination and degradation of FUBP1, a transcriptional activator of MYC, leading to MYC down- regulation which is required for aveolar type II cell differentiation. Blocks MDM2-mediated ubiquitination and degradation of p53/TP53. Functions as a proapoptotic factor.

Chromosomal Location of Human Ortholog: 7p22

Cellular Component: membrane; nucleus; cytosol

Molecular Function: protein binding

Biological Process: negative regulation of cell proliferation; tRNA aminoacylation for protein translation; positive regulation of protein ubiquitination; apoptosis; gene expression

Research Articles on JTV1

Similar Products

Product Notes

The JTV1 aimp2 (Catalog #AAA6187855) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's JTV1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the JTV1 aimp2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "JTV1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.