Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-AIMP2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: MCF7 cell lysateAIMP2 is strongly supported by BioGPS gene expression data to be expressed in Human MCF7 cells)

Rabbit AIMP2 Polyclonal Antibody | anti-AIMP2 antibody

AIMP2 antibody - N-terminal region

Gene Names
AIMP2; P38; JTV1; HLD17; JTV-1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Applications
Western Blot
Purity
Affinity Purified
Synonyms
AIMP2; Polyclonal Antibody; AIMP2 antibody - N-terminal region; anti-AIMP2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SLQALESRQDDILKRLYELKAAVDGLSKMIQTPDADLDVTNIIQADEPTT
Sequence Length
320
Applicable Applications for anti-AIMP2 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Sheep: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human AIMP2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-AIMP2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: MCF7 cell lysateAIMP2 is strongly supported by BioGPS gene expression data to be expressed in Human MCF7 cells)

Western Blot (WB) (WB Suggested Anti-AIMP2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: MCF7 cell lysateAIMP2 is strongly supported by BioGPS gene expression data to be expressed in Human MCF7 cells)
Related Product Information for anti-AIMP2 antibody
This is a rabbit polyclonal antibody against AIMP2. It was validated on Western Blot

Target Description: The JTV1 gene is located on chromosome 7p22 flanked by two genes, HRI and PMS2. JTV1 and HRI overlap slightly and are arranged in a tail-to-tail fashion. JTV1 and PMS2 are separated by approximately 200 base pairs and are arranged head-to-head. JTV1 is transcribed in the opposite direction compared to HRI and PMS2. The function of the JTV1 gene product is unknown.
Product Categories/Family for anti-AIMP2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35kDa
NCBI Official Full Name
aminoacyl tRNA synthase complex-interacting multifunctional protein 2 isoform a
NCBI Official Synonym Full Names
aminoacyl tRNA synthetase complex interacting multifunctional protein 2
NCBI Official Symbol
AIMP2
NCBI Official Synonym Symbols
P38; JTV1; HLD17; JTV-1
NCBI Protein Information
aminoacyl tRNA synthase complex-interacting multifunctional protein 2
UniProt Protein Name
Aminoacyl tRNA synthase complex-interacting multifunctional protein 2
UniProt Gene Name
AIMP2
UniProt Synonym Gene Names
JTV1
UniProt Entry Name
AIMP2_HUMAN

NCBI Description

The protein encoded by this gene is part of the aminoacyl-tRNA synthetase complex, which contains nine different aminoacyl-tRNA synthetases and three non-enzymatic factors. The encoded protein is one of the non-enzymatic factors and is required for assembly and stability of the complex. [provided by RefSeq, May 2016]

Uniprot Description

JTV1: Required for assembly and stability of the aminoacyl- tRNA synthase complex. Mediates ubiquitination and degradation of FUBP1, a transcriptional activator of MYC, leading to MYC down- regulation which is required for aveolar type II cell differentiation. Blocks MDM2-mediated ubiquitination and degradation of p53/TP53. Functions as a proapoptotic factor.

Chromosomal Location of Human Ortholog: 7p22

Cellular Component: membrane; nucleus; cytosol

Molecular Function: protein binding

Biological Process: negative regulation of cell proliferation; tRNA aminoacylation for protein translation; positive regulation of protein ubiquitination; apoptosis; gene expression

Research Articles on AIMP2

Similar Products

Product Notes

The AIMP2 aimp2 (Catalog #AAA3214298) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The AIMP2 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's AIMP2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the AIMP2 aimp2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SLQALESRQD DILKRLYELK AAVDGLSKMI QTPDADLDVT NIIQADEPTT. It is sometimes possible for the material contained within the vial of "AIMP2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.