Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (HS3ST3B1 antibody (MBS5303391) used at 1 ug/ml to detect target protein.)

Rabbit HS3ST3B1 Polyclonal Antibody | anti-HS3ST3B1 antibody

HS3ST3B1 antibody

Gene Names
HS3ST3B1; 3OST3B1; 3-OST-3B; h3-OST-3B
Applications
Western Blot
Purity
Affinity purified
Synonyms
HS3ST3B1; Polyclonal Antibody; HS3ST3B1 antibody; Polyclonal HS3ST3B1; Anti-HS3ST3B1; Heparan Sulfate; 30ST3B1; 3OST3B1; Glucosamine 3-O-Sulfotransferase 3B1; anti-HS3ST3B1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of HS3ST3B1 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
390
Applicable Applications for anti-HS3ST3B1 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
HS3ST3B1 is a member of the heparan sulfate biosynthetic enzyme family. It is a type II integral membrane protein and possesses heparan sulfate glucosaminyl 3-O-sulfotransferase activity. The sulfotransferase domain of this enzyme is highly similar to the same domain of heparan sulfate D-glucosaminyl 3-O-sulfotransferase 3A1, and these two enzymes sulfate an identical disaccharide.
Cross-Reactivity
Human
Immunogen
HS3ST3B1 antibody was raised using a synthetic peptide corresponding to a region with amino acids AMLCVWLYMFLYSCAGSCAAAPGLLLLGSGSRAAHDPPALATAPDGTPPR
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(HS3ST3B1 antibody (MBS5303391) used at 1 ug/ml to detect target protein.)

Western Blot (WB) (HS3ST3B1 antibody (MBS5303391) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-HS3ST3B1 antibody
Rabbit polyclonal HS3ST3B1 antibody
Product Categories/Family for anti-HS3ST3B1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
43 kDa (MW of target protein)
NCBI Official Full Name
heparan sulfate glucosamine 3-O-sulfotransferase 3B1
NCBI Official Synonym Full Names
heparan sulfate (glucosamine) 3-O-sulfotransferase 3B1
NCBI Official Symbol
HS3ST3B1
NCBI Official Synonym Symbols
3OST3B1; 3-OST-3B; h3-OST-3B
NCBI Protein Information
heparan sulfate glucosamine 3-O-sulfotransferase 3B1
UniProt Protein Name
Heparan sulfate glucosamine 3-O-sulfotransferase 3B1
UniProt Gene Name
HS3ST3B1
UniProt Synonym Gene Names
3OST3B1; HS3ST3B; 3-OST-3B; Heparan sulfate 3-O-sulfotransferase 3B1; h3-OST-3B
UniProt Entry Name
HS3SB_HUMAN

NCBI Description

The protein encoded by this gene is a type II integral membrane protein that belongs to the 3-O-sulfotransferases family. These proteins catalyze the addition of sulfate groups at the 3-OH position of glucosamine in heparan sulfate. The substrate specificity of individual members of the family is based on prior modification of the heparan sulfate chain, thus allowing different members of the family to generate binding sites for different proteins on the same heparan sulfate chain. Following treatment with a histone deacetylase inhibitor, expression of this gene is activated in a pancreatic cell line. The increased expression results in promotion of the epithelial-mesenchymal transition. In addition, the modification catalyzed by this protein allows herpes simplex virus membrane fusion and penetration. A very closely related homolog with an almost identical sulfotransferase domain maps less than 1 Mb away. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2014]

Uniprot Description

HS3ST3B1: Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) to catalyze the transfer of a sulfo group to an N- unsubstituted glucosamine linked to a 2-O-sulfo iduronic acid unit on heparan sulfate. Catalyzes the O-sulfation of glucosamine in IdoUA2S-GlcNS and also in IdoUA2S-GlcNH2. The substrate-specific O-sulfation generates an enzyme-modified heparan sulfate which acts as a binding receptor to Herpes simplex virus-1 (HSV-1) and permits its entry. Unlike 3-OST-1, does not convert non- anticoagulant heparan sulfate to anticoagulant heparan sulfate. Belongs to the sulfotransferase 1 family.

Protein type: Glycan Metabolism - heparan sulfate biosynthesis; Membrane protein, integral; Transferase; Glycan Metabolism - glycosaminoglycan degradation; EC 2.8.2.30

Chromosomal Location of Human Ortholog: 17p12

Cellular Component: Golgi membrane; integral to plasma membrane

Molecular Function: [heparan sulfate]-glucosamine 3-sulfotransferase 3 activity; heparin-glucosamine 3-O-sulfotransferase activity

Biological Process: glycosaminoglycan biosynthetic process; glycosaminoglycan metabolic process; heparan sulfate proteoglycan biosynthetic process, enzymatic modification; heparan sulfate proteoglycan biosynthetic process; carbohydrate metabolic process; pathogenesis

Research Articles on HS3ST3B1

Similar Products

Product Notes

The HS3ST3B1 hs3st3b1 (Catalog #AAA5303391) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's HS3ST3B1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the HS3ST3B1 hs3st3b1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HS3ST3B1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.