Mouse anti-Human ITPKB Monoclonal Antibody | anti-ITPKB antibody

ITPKB (Inositol-trisphosphate 3-kinase B, Inositol 1,4,5-trisphosphate 3-kinase B, IP3 3-kinase B, IP3K B, InsP 3-kinase B) (HRP)

Cat. Num. AAA6153144

• Gene Names: ITPKB; IP3K; IP3KB; PIG37; IP3K-B; IP3-3KB
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: ITPKB; Monoclonal Antibody; ITPKB (Inositol-trisphosphate 3-kinase B; Inositol 1; 4; 5-trisphosphate 3-kinase B; IP3 3-kinase B; IP3K B; InsP 3-kinase B) (HRP); anti-ITPKB antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 2F8
• Specificity: Recognizes human ITPKB.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-ITPKB antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa545-643 from human ITPKB (NP_002212) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: PELLPQDQDKPFLRKACSPSNIPAVIITDMGTQEDGALEETQGSPRGNLPLRKLSSSSASSTGFSSSYEDSEEDISSDPERTLDPNSAFLHTLDQQKPR
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.52kD).)

Western Blot (WB)

(ITPKB monoclonal antibody Western Blot analysis of ITPKB expression in Jurkat.)

Western Blot (WB)

(Western Blot analysis of ITPKB expression in transfected 293T cell line by ITPKB monoclonal antibody. Lane 1: ITPKB transfected lysate (67.4kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-ITPKB antibody

ITPKB regulates inositol phosphate metabolism by phosphorylation of second messenger inositol 1,4,5-trisphosphate to Ins(1,3,4,5)P4. The activity of this encoded protein is responsible for regulating the levels of a large number of inositol polyphosphates that are important in cellular signaling. Both calcium/calmodulin and protein phosphorylation mechanisms control its activity.

Product Categories/Family for anti-ITPKB antibody

Antibodies; Protein Kinases

References

1. Human inositol-1,4,5-trisphosphate 3-kinase isoform B (IP3KB) is a nucleocytoplasmic shuttling protein specifically enriched at cortical actin filaments and at invaginations of the nuclear envelope. Nalaskowski MM, Fliegert R, Ernst O, Brehm MA, Fanick W, Windhorst S, Lin H, Giehler S, Hein J, Lin YN, Mayr GW.J Biol Chem. 2010 Dec 9.

NCBI and Uniprot Product Information

• NCBI GI #: 194272161
• NCBI GeneID: 3707
• NCBI Accession #: NP_002212
• NCBI GenBank Nucleotide #: NM_002221
• UniProt Accession #: P27987; Q5VWL9; Q5VWM0; Q96BZ2; Q96JS1; Q9UH47
• Molecular Weight: 67,387 Da
• NCBI Official Full Name: inositol-trisphosphate 3-kinase B
• NCBI Official Synonym Full Names: inositol-trisphosphate 3-kinase B
• NCBI Official Symbol: ITPKB
• NCBI Official Synonym Symbols: IP3K; IP3KB; PIG37; IP3K-B; IP3-3KB
• NCBI Protein Information: inositol-trisphosphate 3-kinase B
• UniProt Protein Name: Inositol-trisphosphate 3-kinase B
• Protein Family: Inositol-trisphosphate 3-kinase
• UniProt Gene Name: ITPKB
• UniProt Synonym Gene Names: IP3 3-kinase B; IP3K B
• UniProt Entry Name: IP3KB_HUMAN

NCBI Description

The protein encoded by this protein regulates inositol phosphate metabolism by phosphorylation of second messenger inositol 1,4,5-trisphosphate to Ins(1,3,4,5)P4. The activity of this encoded protein is responsible for regulating the levels of a large number of inositol polyphosphates that are important in cellular signaling. Both calcium/calmodulin and protein phosphorylation mechanisms control its activity. [provided by RefSeq, Jul 2008]

Uniprot Description

ITPKB: The protein encoded by this protein regulates inositol phosphate metabolism by phosphorylation of second messenger inositol 1,4,5-trisphosphate to Ins(1,3,4,5)P4. The activity of this encoded protein is responsible for regulating the levels of a large number of inositol polyphosphates that are important in cellular signaling. Both calcium/calmodulin and protein phosphorylation mechanisms control its activity. [provided by RefSeq, Jul 2008]

Protein type: Motility/polarity/chemotaxis; EC 2.7.1.127; Carbohydrate Metabolism - inositol phosphate; Kinase, lipid

Chromosomal Location of Human Ortholog: 1q42.13

Cellular Component: cytosol

Molecular Function: calmodulin binding; protein binding; inositol trisphosphate 3-kinase activity; ATP binding

Biological Process: cell surface receptor linked signal transduction; inositol phosphate metabolic process; MAPKKK cascade; positive regulation of Ras protein signal transduction; signal transduction; positive regulation of alpha-beta T cell differentiation; positive thymic T cell selection