Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.84kD).)

Mouse anti-Human ITGA4 Monoclonal Antibody | anti-ITGA4 antibody

ITGA4 (Integrin alpha-4, CD49 Antigen-like Family Member D, Integrin alpha-IV, VLA-4 Subunit alpha, CD49d, MGC90518) (AP)

Gene Names
ITGA4; IA4; CD49D
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ITGA4; Monoclonal Antibody; ITGA4 (Integrin alpha-4; CD49 Antigen-like Family Member D; Integrin alpha-IV; VLA-4 Subunit alpha; CD49d; MGC90518) (AP); anti-ITGA4 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2C11
Specificity
Recognizes human ITGA4.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-ITGA4 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa98-207 from human ITGA4 (NP_000876) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
RIGKNPGQTCEQLQLGSPNGEPCGKTCLEERDNQWLGVTLSRQPGENGSIVTCGHRWKNIFYIKNENKLPTGGCYGVPPDLRTELSKRIAPCYQDYVKKFGENFASCQAG
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.84kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.84kD).)

Western Blot (WB)

(ITGA4 monoclonal antibody Western Blot analysis of ITGA4 expression in Jurkat.)

Western Blot (WB) (ITGA4 monoclonal antibody Western Blot analysis of ITGA4 expression in Jurkat.)

Testing Data

(Detection limit for recombinant GST tagged ITGA4 is ~0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged ITGA4 is ~0.3ng/ml as a capture antibody.)
Related Product Information for anti-ITGA4 antibody
ITGA4s are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. It belongs to the integrin alpha chain family of proteins. The gene of this protein encodes an alpha 4 chain. Unlike other integrin alpha chains, alpha 4 neither contains an I-domain, nor undergoes disulfide-linked cleavage. Alpha 4 chain associates with either beta 1 chain or beta 7 chain. CD14 is a novel ligand for alpha4beta1, exhibiting similar activation-state dependent binding characteristics as other alpha4beta1 ligands.
Product Categories/Family for anti-ITGA4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
21,536 Da
NCBI Official Full Name
integrin alpha-4
NCBI Official Synonym Full Names
integrin, alpha 4 (antigen CD49D, alpha 4 subunit of VLA-4 receptor)
NCBI Official Symbol
ITGA4
NCBI Official Synonym Symbols
IA4; CD49D
NCBI Protein Information
integrin alpha-4; 269C wild type; integrin alpha 4; integrin alpha-IV; VLA-4 subunit alpha; integrin alpha-4 subunit; CD49 antigen-like family member D; antigen CD49D, alpha-4 subunit of VLA-4 receptor; very late activation protein 4 receptor, alpha 4 sub
UniProt Protein Name
Integrin alpha-4
Protein Family
UniProt Gene Name
ITGA4
UniProt Synonym Gene Names
CD49D
UniProt Entry Name
ITA4_HUMAN

NCBI Description

The product of this gene belongs to the integrin alpha chain family of proteins. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. This gene encodes an alpha 4 chain. Unlike other integrin alpha chains, alpha 4 neither contains an I-domain, nor undergoes disulfide-linked cleavage. Alpha 4 chain associates with either beta 1 chain or beta 7 chain. [provided by RefSeq, Jul 2008]

Uniprot Description

ITGA4: Integrins alpha-4/beta-1 (VLA-4) and alpha-4/beta-7 are receptors for fibronectin. They recognize one or more domains within the alternatively spliced CS-1 and CS-5 regions of fibronectin. They are also receptors for VCAM1. Integrin alpha- 4/beta-1 recognizes the sequence Q-I-D-S in VCAM1. Integrin alpha- 4/beta-7 is also a receptor for MADCAM1. It recognizes the sequence L-D-T in MADCAM1. On activated endothelial cells integrin VLA-4 triggers homotypic aggregation for most VLA-4-positive leukocyte cell lines. It may also participate in cytolytic T-cell interactions with target cells. Heterodimer of an alpha and a beta subunit. The alpha subunit can sometimes be cleaved into two non-covalently associated fragments. Alpha-4 associates with either beta-1 or beta-7. Alpha-4 interacts with PXN, LPXN, and TGFB1I1/HIC5. Interacts with CSPG4 through CSPG4 chondroitin sulfate glycosaminoglycan. Belongs to the integrin alpha chain family.

Protein type: Motility/polarity/chemotaxis; Membrane protein, integral; Cell adhesion; Receptor, misc.

Chromosomal Location of Human Ortholog: 2q31.3

Cellular Component: focal adhesion; cell surface; membrane; plasma membrane; intercellular junction; external side of plasma membrane

Molecular Function: protein binding; fibronectin binding; metal ion binding; cell adhesion molecule binding

Biological Process: integrin-mediated signaling pathway; regulation of immune response; extracellular matrix organization and biogenesis; heart development; cell-matrix adhesion; receptor clustering; heterophilic cell adhesion; heterotypic cell-cell adhesion; leukocyte adhesion; B cell differentiation; blood vessel remodeling; blood coagulation; leukocyte tethering or rolling; leukocyte migration

Research Articles on ITGA4

Similar Products

Product Notes

The ITGA4 itga4 (Catalog #AAA6131914) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ITGA4 (Integrin alpha-4, CD49 Antigen-like Family Member D, Integrin alpha-IV, VLA-4 Subunit alpha, CD49d, MGC90518) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ITGA4 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ITGA4 itga4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ITGA4, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.