Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Mouse anti-Human B3GNT2 Monoclonal Antibody | anti-B3GNT2 antibody

B3GNT2 (UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 2, BGnT-2, Beta-1,3-Gn-T2, Beta-1,3-N-acetylglucosaminyltransferase 2, Beta3Gn-T2, Beta-1,3-N-acetylglucosaminyltransferase 1, BGnT-1, Beta-1,3-Gn-T1, Beta3Gn-T1, Beta-1,3-galactosyltrans

Gene Names
B3GNT2; B3GNT; BGNT2; B3GNT1; BGnT-2; beta-1; 3-Gn-T1; 3-Gn-T2; B3GN-T2; B3GNT-2; BETA3GNT; beta3Gn-T1; beta3Gn-T2
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
B3GNT2; Monoclonal Antibody; B3GNT2 (UDP-GlcNAc:betaGal beta-1; 3-N-acetylglucosaminyltransferase 2; BGnT-2; Beta-1; 3-Gn-T2; Beta3Gn-T2; 3-N-acetylglucosaminyltransferase 1; BGnT-1; 3-Gn-T1; Beta3Gn-T1; 3-galactosyltrans; anti-B3GNT2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1A8
Specificity
Recognizes human B3GNT1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-B3GNT2 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa111-210 from human B3GNT1 (NP_006568) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
NLPDRFKDFLLYLRCRNYSLLIDQPDKCAKKPFLLLAIKSLTPHFARRQAIRESWGQESNAGNQTVVRVFLLGQTPPEDNHPDLSDMLKFESEKHQDILM
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB)

(Western Blot analysis of B3GNT1 expression in transfected 293T cell line by B3GNT1 monoclonal antibody Lane 1: B3GNT1 transfected lysate (46.022kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of B3GNT1 expression in transfected 293T cell line by B3GNT1 monoclonal antibody Lane 1: B3GNT1 transfected lysate (46.022kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged B3GNT1 is ~0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged B3GNT1 is ~0.3ng/ml as a capture antibody.)
Related Product Information for anti-B3GNT2 antibody
This gene encodes a member of the beta-1,3-N-acetylglucosaminyltransferase family. This enzyme is a type II transmembrane protein. It is essential for the synthesis of poly-N-acetyllactosamine, a determinant for the blood group i antigen.
Product Categories/Family for anti-B3GNT2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43.5kDa (375aa) 40-57kDa (SDS-PAGE under reducing conditions)
NCBI Official Full Name
N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2
NCBI Official Synonym Full Names
UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 2
NCBI Official Symbol
B3GNT2
NCBI Official Synonym Symbols
B3GNT; BGNT2; B3GNT1; BGnT-2; beta-1; 3-Gn-T1; 3-Gn-T2; B3GN-T2; B3GNT-2; BETA3GNT; beta3Gn-T1; beta3Gn-T2
NCBI Protein Information
N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2
UniProt Protein Name
N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2
UniProt Gene Name
B3GNT2
UniProt Synonym Gene Names
B3GALT7; B3GNT1; BGnT-1; Beta-1,3-Gn-T1; Beta3Gn-T1; Beta-1,3-GalTase 7; Beta3Gal-T7; Beta3GalT7; b3Gal-T7; BGnT-2; Beta-1,3-Gn-T2; Beta-1,3-N-acetylglucosaminyltransferase 2; Beta3Gn-T2

NCBI Description

This gene encodes a member of the beta-1,3-N-acetylglucosaminyltransferase family. This enzyme is a type II transmembrane protein. It prefers the substrate of lacto-N-neotetraose, and is involved in the biosynthesis of poly-N-acetyllactosamine chains. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jan 2016]

Uniprot Description

B3GNT2: Catalyzes the initiation and elongation of poly-N- acetyllactosamine chains. Belongs to the glycosyltransferase 31 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Cell development/differentiation; EC 2.4.1.-; Glycan Metabolism - glycosphingolipid biosynthesis - lacto and neolacto series; Glycan Metabolism - keratan sulfate biosynthesis; Membrane protein, integral; Motility/polarity/chemotaxis; Transferase

Chromosomal Location of Human Ortholog: 2p15

Cellular Component: Golgi membrane

Molecular Function: N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase activity; UDP-galactose:beta-N-acetylglucosamine beta-1,3-galactosyltransferase activity

Biological Process: keratan sulfate biosynthetic process; O-glycan processing; poly-N-acetyllactosamine biosynthetic process

Research Articles on B3GNT2

Similar Products

Product Notes

The B3GNT2 b3gnt2 (Catalog #AAA6140768) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The B3GNT2 (UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 2, BGnT-2, Beta-1,3-Gn-T2, Beta-1,3-N-acetylglucosaminyltransferase 2, Beta3Gn-T2, Beta-1,3-N-acetylglucosaminyltransferase 1, BGnT-1, Beta-1,3-Gn-T1, Beta3Gn-T1, Beta-1,3-galactosyltrans reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's B3GNT2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the B3GNT2 b3gnt2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "B3GNT2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.