Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.84kD).)

Mouse anti-Human IRF1 Monoclonal Antibody | anti-IRF1 antibody

IRF1 (Interferon Regulatory Factor 1, IRF-1, MAR) APC

Gene Names
IRF1; MAR; IRF-1
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
IRF1; Monoclonal Antibody; IRF1 (Interferon Regulatory Factor 1; IRF-1; MAR) APC; anti-IRF1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2E4
Specificity
Recognizes human IRF1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-IRF1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa216-325 from human IRF1 (NP_002189) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PMPSTSEATTDEDEEGKLPEDIMKLLEQSEWQPTNVDGKGYLLNEPGVQPTSVYGDFSCKEEPEIDSPGGDIGLSLQRVFTDLKNMDATWLDSLLTPVRLPSIQAIPCAP
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.84kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.84kD).)

Western Blot (WB)

(IRF1 monoclonal antibody Western Blot analysis of IRF1 expression in COLO 320 HSR.)

Western Blot (WB) (IRF1 monoclonal antibody Western Blot analysis of IRF1 expression in COLO 320 HSR.)

Testing Data

(Detection limit for recombinant GST tagged IRF1 is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged IRF1 is ~0.1ng/ml as a capture antibody.)
Product Categories/Family for anti-IRF1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
15 kDa (134 aa), confirmed by MALDI-TOF.
NCBI Official Full Name
interferon regulatory factor 1 isoform 1
NCBI Official Synonym Full Names
interferon regulatory factor 1
NCBI Official Symbol
IRF1
NCBI Official Synonym Symbols
MAR; IRF-1
NCBI Protein Information
interferon regulatory factor 1
UniProt Protein Name
Interferon regulatory factor 1
UniProt Gene Name
IRF1
UniProt Synonym Gene Names
IRF-1
UniProt Entry Name
IRF1_HUMAN

NCBI Description

The protein encoded by this gene is a transcriptional regulator and tumor suppressor, serving as an activator of genes involved in both innate and acquired immune responses. The encoded protein activates the transcription of genes involved in the body's response to viruses and bacteria, playing a role in cell proliferation, apoptosis, the immune response, and DNA damage response. This protein represses the transcription of several other genes. As a tumor suppressor, it both suppresses tumor cell growth and stimulates an immune response against tumor cells. Defects in this gene have been associated with gastric cancer, myelogenous leukemia, and lung cancer. [provided by RefSeq, Aug 2017]

Uniprot Description

IRF1: a transcriptional regulator which displays a remarkable functional diversity in the regulation of cellular responses. These include the regulation of IFN and IFN-inducible genes, host response to viral and bacterial infections, regulation of many genes expressed during hematopoiesis, inflammation, immune responses and cell proliferation and differentiation, regulation of the cell cycle and induction of growth arrest and programmed cell death following DNA damage. Stimulates both innate and acquired immune responses through the activation of specific target genes and can act as a transcriptional activator and repressor regulating target genes by binding to an interferon- stimulated response element (ISRE) in their promoters. Its target genes for transcriptional activation activity include: genes involved in anti-viral response, such as IFN-alpha/beta, DDX58, TRAIL, OAS1/2, PIAS1, PKR and RSAD2; antibacterial response, such as iNOS; anti- proliferative response, such as p53, LOX and CDKN1A; apoptosis, such as PUMA, CASP1, CASP7 and CASP8; immune response, such as IL7, IL12A/B and IL15, COX-2 and CYBB; DNA damage responses and DNA repair, such as POLQ; MHC class I expression, such as TAP1, PSMB9, PSME1, PSME2 and B2M and MHC class II expression, such as CIITA. Represses genes involved in anti-proliferative response, such as survivin, CCNB1, CCNE1, CDK1, CDK2 and CDK4 and in immune response, such as FOXP3, IL4, ANXA2 and TLR4. Stimulates p53-dependent transcription through enhanced recruitment of EP300 leading to increased acetylation of p53. Plays an important role in immune response directly affecting NK maturation and activity, macrophage production of IL12, Th1 development and maturation of CD8+ T-cells. Also implicated in the differentiation and maturation of dendritic cells and in the suppression of regulatory T (Treg) cells development. Acts as a tumor suppressor and plays a role not only in antagonism of tumor cell growth but also in stimulating an immune response against tumor cells. Defects in IRF1 are a cause of gastric adenocarcinoma (GASC), accounting for most of all gastric malignant tumors. Deletions or rearrangements of IRF1 can occur in preleukemic myelodysplastic syndrome (MDS) and acute myelogenous leukemia (AML).

Protein type: Transcription factor; Tumor suppressor

Chromosomal Location of Human Ortholog: 5q31.1

Cellular Component: nucleoplasm; cytoplasm; nuclear chromatin; cytosol; nucleus

Molecular Function: protein binding; DNA binding

Biological Process: transcription from RNA polymerase II promoter; CD8-positive, alpha-beta T cell differentiation; apoptosis; regulation of cell cycle; positive regulation of transcription, DNA-dependent; cytokine and chemokine mediated signaling pathway; regulation of MyD88-dependent toll-like receptor signaling pathway; regulation of innate immune response; negative regulation of cell proliferation; regulation of adaptive immune response; positive regulation of interleukin-12 biosynthetic process; negative regulation of regulatory T cell differentiation; positive regulation of interferon-beta production; positive regulation of interferon type I production; positive regulation of transcription from RNA polymerase II promoter; negative regulation of transcription, DNA-dependent; cell cycle arrest; blood coagulation; defense response to virus

Disease: Gastric Cancer; Lung Cancer

Research Articles on IRF1

Similar Products

Product Notes

The IRF1 irf1 (Catalog #AAA6137202) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The IRF1 (Interferon Regulatory Factor 1, IRF-1, MAR) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's IRF1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the IRF1 irf1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "IRF1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.