Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit is ~0.3ng/ml using 128575 as a capture antibody.)

Mouse anti-Human IRAK3 Monoclonal Antibody | anti-IRAK3 antibody

IRAK3 (Interleukin-1 Receptor-associated Kinase 3, IRAK-3, IL-1 Receptor-associated Kinase M, IRAK-M) (FITC)

Gene Names
IRAK3; ASRT5; IRAKM
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
IRAK3; Monoclonal Antibody; IRAK3 (Interleukin-1 Receptor-associated Kinase 3; IRAK-3; IL-1 Receptor-associated Kinase M; IRAK-M) (FITC); anti-IRAK3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1F6
Specificity
Recognizes human IRAK3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-IRAK3 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa497-596 from human IRAK3 with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
RIDRMTQKTPFECSQSEVMFLSLDKKPESKRNEEACNMPSSSCEESWFPKYIVPSQDLRPYKVNIDPSSEAPGHSCRSRPVESSCSSKFSWDEYEQYKKE
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit is ~0.3ng/ml using 128575 as a capture antibody.)

Testing Data (Detection limit is ~0.3ng/ml using 128575 as a capture antibody.)

Western Blot (WB)

(Western Blot analysis of IRAK3 expression in HeLa using 128575.)

Western Blot (WB) (Western Blot analysis of IRAK3 expression in HeLa using 128575.)

Western Blot (WB)

(Western Blot analysis of IRAK3 expression in transfected 293T cell line using 128575. Lane 1: IRAK3 transfected lysate (67.8kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of IRAK3 expression in transfected 293T cell line using 128575. Lane 1: IRAK3 transfected lysate (67.8kD). Lane 2: Non-transfected lysate.)

Western Blot (WB)

(Western Blot detection against immunogen using 128575 (37kD).)

Western Blot (WB) (Western Blot detection against immunogen using 128575 (37kD).)

Western Blot (WB)

(Western Blot analysis of IRAK3 over-expressed 293 cell line, cotransfected with IRAK3 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with 128575. GAPDH (36.1kD) used as specificity and loading control.)

Western Blot (WB) (Western Blot analysis of IRAK3 over-expressed 293 cell line, cotransfected with IRAK3 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with 128575. GAPDH (36.1kD) used as specificity and loading control.)
Related Product Information for anti-IRAK3 antibody
Inhibits dissociation of IRAK1 and IRAK4 from the Toll-like receptor signaling complex by either inhibiting the phosphorylation of IRAK1 and IRAK4 or stabilizing the receptor complex.
Product Categories/Family for anti-IRAK3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
~96 kDa
NCBI Official Full Name
Homo sapiens interleukin-1 receptor-associated kinase 3, mRNA
NCBI Official Synonym Full Names
interleukin-1 receptor-associated kinase 3
NCBI Official Symbol
IRAK3
NCBI Official Synonym Symbols
ASRT5; IRAKM
NCBI Protein Information
interleukin-1 receptor-associated kinase 3; IL-1 receptor-associated kinase M
UniProt Protein Name
Interleukin-1 receptor-associated kinase 3
UniProt Gene Name
IRAK3
UniProt Synonym Gene Names
IRAK-3; IRAK-M
UniProt Entry Name
IRAK3_HUMAN

NCBI Description

This gene encodes a member of the interleukin-1 receptor-associated kinase protein family. Members of this family are essential components of the Toll/IL-R immune signal transduction pathways. This protein is primarily expressed in monocytes and macrophages and functions as a negative regulator of Toll-like receptor signaling. Mutations in this gene are associated with a susceptibility to asthma. Alternate splicing results in multiple transcript variants. [provided by RefSeq, May 2010]

Uniprot Description

IRAK3: a TKL kinase of the IRAK family. The interleukin-1 receptor-associated kinases are important mediators in the signal transduction of Toll-like receptor and IL1R family members, collectively referred to as TIRs.

Protein type: Protein kinase, TKL; Kinase, protein; Protein kinase, Ser/Thr (non-receptor); EC 2.7.11.1; TKL group; IRAK family

Chromosomal Location of Human Ortholog: 12q14.3

Cellular Component: interleukin-1 receptor complex; cytoplasm; nucleus

Molecular Function: protein serine/threonine kinase activity; protein homodimerization activity; protein heterodimerization activity; magnesium ion binding; ATP binding

Biological Process: negative regulation of MAP kinase activity; regulation of protein complex disassembly; negative regulation of interleukin-12 production; cytokine and chemokine mediated signaling pathway; response to virus; protein amino acid autophosphorylation; response to lipopolysaccharide; negative regulation of tumor necrosis factor production; protein amino acid phosphorylation; activation of NF-kappaB transcription factor; MyD88-dependent toll-like receptor signaling pathway; response to exogenous dsRNA; negative regulation of innate immune response; inhibition of NF-kappaB transcription factor; response to peptidoglycan; toll-like receptor signaling pathway; negative regulation of interleukin-6 production; negative regulation of toll-like receptor signaling pathway; negative regulation of cytokine and chemokine mediated signaling pathway; negative regulation of protein catabolic process; negative regulation of protein complex disassembly

Disease: Asthma-related Traits, Susceptibility To, 5

Research Articles on IRAK3

Similar Products

Product Notes

The IRAK3 irak3 (Catalog #AAA6147805) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The IRAK3 (Interleukin-1 Receptor-associated Kinase 3, IRAK-3, IL-1 Receptor-associated Kinase M, IRAK-M) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's IRAK3 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the IRAK3 irak3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "IRAK3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.