Mouse IRAK2 Monoclonal Antibody | anti-IRAK2 antibody

IRAK2 (Interleukin-1 Receptor-Associated Kinase 2, IRAK-2, MGC150550) (APC)

Cat. Num. AAA6166032

• Gene Names: IRAK2; IRAK-2
• Applications: Western Blot
• Purity: Purified
• Synonyms: IRAK2; Monoclonal Antibody; IRAK2 (Interleukin-1 Receptor-Associated Kinase 2; IRAK-2; MGC150550) (APC); Interleukin-1 Receptor-Associated Kinase 2; MGC150550; anti-IRAK2 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 4C11
• Specificity: Recognizes IRAK2.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).

• Applicable Applications for anti-IRAK2 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: IRAK2 (NP_001561, 111aa-210aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: KPEKPLAASVRKAEDEQEEGQPVRMATFPGPGSSPARAHQPAFLQPPEEDAPHSLRSDLPTSSDSKDFSTSIPKQEKLLSLAGDSLFWSEADVVQATDDF
• Conjugate: APC
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(IRAK2 monoclonal antibody (M06), clone 4C11 Western Blot analysis of IRAK2 expression in NIH/3T3 (Cat # L018V1).)

Testing Data

(Detection limit for recombinant GST tagged IRAK2 is approximately 0.03ng/ml as a capture antibody.)

Related Product Information for anti-IRAK2 antibody

IRAK2 encodes the interleukin-1 receptor-associated kinase 2, one of two putative serine/threonine kinases that become associated with the interleukin-1 receptor (IL1R) upon stimulation. IRAK2 is reported to participate in the IL1-induced upregulation of NF-kappaB. [provided by RefSeq]

Product Categories/Family for anti-IRAK2 antibody

Antibodies; Protein Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 58530886
• NCBI GeneID: 3656
• NCBI Accession #: NP_001561
• NCBI GenBank Nucleotide #: NM_001570
• UniProt Accession #: O43187; Q08AG6; Q5K546; B4DQZ6
• Molecular Weight: 69,433 Da
• NCBI Official Full Name: interleukin-1 receptor-associated kinase-like 2
• NCBI Official Synonym Full Names: interleukin-1 receptor-associated kinase 2
• NCBI Official Symbol: IRAK2
• NCBI Official Synonym Symbols: IRAK-2
• NCBI Protein Information: interleukin-1 receptor-associated kinase-like 2; interleukin-1 receptor associated kinase-2
• UniProt Protein Name: Interleukin-1 receptor-associated kinase-like 2
• Protein Family: Interleukin-1 receptor-associated kinase
• UniProt Gene Name: IRAK2
• UniProt Synonym Gene Names: IRAK-2
• UniProt Entry Name: IRAK2_HUMAN

Uniprot Description

IRAK2: Binds to the IL-1 type I receptor following IL-1 engagement, triggering intracellular signaling cascades leading to transcriptional up-regulation and mRNA stabilization. Interacts with MYD88. IL-1 stimulation leads to the formation of a signaling complex which dissociates from the IL-1 receptor following the binding of PELI1. Expressed in spleen, thymus, prostate, lung, liver, skeletal muscle, kidney, pancreas and peripheral blood leukocytes. Belongs to the protein kinase superfamily. TKL Ser/Thr protein kinase family. Pelle subfamily.

Protein type: Protein kinase, Ser/Thr (non-receptor); Protein kinase, TKL; Kinase, protein; TKL group; IRAK family

Chromosomal Location of Human Ortholog: 3p25.3

Cellular Component: interleukin-1 receptor complex; cytoplasm; plasma membrane; endosome membrane; cytosol; nucleus

Molecular Function: protein serine/threonine kinase activity; protein binding; protein homodimerization activity; protein heterodimerization activity; ATP binding

Biological Process: I-kappaB kinase/NF-kappaB cascade; activation of MAPK activity; MyD88-independent toll-like receptor signaling pathway; stress-activated MAPK cascade; toll-like receptor 3 signaling pathway; protein amino acid phosphorylation; activation of NF-kappaB transcription factor; toll-like receptor 2 signaling pathway; toll-like receptor 10 signaling pathway; MyD88-dependent toll-like receptor signaling pathway; toll-like receptor 5 signaling pathway; inhibition of NF-kappaB transcription factor; lipopolysaccharide-mediated signaling pathway; toll-like receptor signaling pathway; innate immune response; regulation of cytokine and chemokine mediated signaling pathway; JNK cascade; toll-like receptor 9 signaling pathway; inflammatory response; toll-like receptor 4 signaling pathway