Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Mouse anti-Human IMMT Monoclonal Antibody | anti-IMMT antibody

IMMT (Mitochondrial Inner Membrane Protein, Mitofilin, p87/89, Cell Proliferation-inducing Gene 4 Protein, HMP, PIG4, PIG52, DKFZp779P1653, MGC111146) (PE)

Gene Names
IMMT; HMP; P87; P89; PIG4; Mic60; PIG52; MINOS2; P87/89
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
IMMT; Monoclonal Antibody; IMMT (Mitochondrial Inner Membrane Protein; Mitofilin; p87/89; Cell Proliferation-inducing Gene 4 Protein; HMP; PIG4; PIG52; DKFZp779P1653; MGC111146) (PE); anti-IMMT antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1A8
Specificity
Recognizes human IMMT.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-IMMT antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa481-581 from human IMMT (NP_006830) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
TQLRRQAAAHTDHLRDVLRVQEQELKSEFEQNLSEKLSEQELQFRRLSQEQVDNFTLDINTAYARLRGIEQAVQSHAVAEEEARKAHQLWLSVEALKYSM
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)
Related Product Information for anti-IMMT antibody
Mitochondria are the center of cellular energy production and essential metabolic reactions. As double membrane-bound organelles, mitochondria from different species, tissues, and metabolic states are highly polymorphic in nature, yet exhibit common structural features. The ultrastructural variations in mitochondrial architecture occur mainly due to the differences in the amount and shape of cristae. Abundant cristae are found in mitochondria from tissues where energy demand is high. Analysis of the human heart mitochondrial proteome shows that mitofilin is one of the most abundant mitochondrial proteins. It appears to play an important role in the maintenance of cristae morphology.
Product Categories/Family for anti-IMMT antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
83,549 Da
NCBI Official Full Name
MICOS complex subunit MIC60 isoform 1
NCBI Official Synonym Full Names
inner membrane mitochondrial protein
NCBI Official Symbol
IMMT
NCBI Official Synonym Symbols
HMP; P87; P89; PIG4; Mic60; PIG52; MINOS2; P87/89
NCBI Protein Information
MICOS complex subunit MIC60
UniProt Protein Name
MICOS complex subunit MIC60
UniProt Gene Name
IMMT
UniProt Synonym Gene Names
HMP; MIC60; MINOS2
UniProt Entry Name
MIC60_HUMAN

Uniprot Description

IMMT: 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Mitochondrial; Membrane protein, integral

Chromosomal Location of Human Ortholog: 2p11.2|2

Cellular Component: mitochondrion; membrane; mitochondrial inner membrane; integral to membrane

Molecular Function: protein binding

Biological Process: mitochondrial calcium ion homeostasis; response to cold

Research Articles on IMMT

Similar Products

Product Notes

The IMMT immt (Catalog #AAA6158385) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The IMMT (Mitochondrial Inner Membrane Protein, Mitofilin, p87/89, Cell Proliferation-inducing Gene 4 Protein, HMP, PIG4, PIG52, DKFZp779P1653, MGC111146) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's IMMT can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the IMMT immt for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "IMMT, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.