Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged IL18RAP is 0.3ng/ml as a capture antibody.)

Mouse anti-Human IL18RAP Monoclonal Antibody | anti-IL18RAP antibody

IL18RAP (Interleukin-18 Receptor Accessory Protein, IL-18 Receptor Accessory Protein, IL-18RAcP, Accessory Protein-like, AcPL, CD218 Antigen-like Family Member B, CDw218b, IL-1R Accessory Protein-like, IL-1RAcPL, Interleukin-1 Receptor 7, IL-1R-7, IL-1R7,

Gene Names
IL18RAP; ACPL; CD218b; IL-1R7; IL18RB; CDw218b; IL-1R-7; IL-18RAcP; IL-1RAcPL; IL-18Rbeta; IL-18R-beta
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
IL18RAP; Monoclonal Antibody; IL18RAP (Interleukin-18 Receptor Accessory Protein; IL-18 Receptor Accessory Protein; IL-18RAcP; Accessory Protein-like; AcPL; CD218 Antigen-like Family Member B; CDw218b; IL-1R Accessory Protein-like; IL-1RAcPL; Interleukin-1 Receptor 7; IL-1R-7; IL-1R7; ; anti-IL18RAP antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4G4
Specificity
Recognizes human IL18RAP.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-IL18RAP antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa20-129 from IL18RAP (NP_003844) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
FNISGCSTKKLLWTYSTRSEEEFVLFCDLPEPQKSHFCHRNRLSPKQVPEHLPFMGSNDLSDVQWYQQPSNGDPLEDIRKSYPHIIQDKCTLHFLTPGVNNSGSYICRPK
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged IL18RAP is 0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged IL18RAP is 0.3ng/ml as a capture antibody.)
Related Product Information for anti-IL18RAP antibody
Required for the high affinity binding of interleukin 18 (IL-18) to its receptor complex. Together with IL18R1 mediates IL-18-dependent activation of NF-kappa-B and JNK.
Product Categories/Family for anti-IL18RAP antibody
References
1. Gene expression profiling in the synovium identifies a predictive signature of absence of response to adalimumab therapy in rheumatoid arthritis. Badot V, Galant C, Nzeusseu Toukap A, Theate I, Maudoux AL, Van den Eynde BJ, Durez P, Houssiau FA, Lauwerys BR.Arthritis Res Ther. 2009;11(2):R57. Epub 2009 Apr 23. 2. Association study of the IL18RAP locus in three European populations with coeliac disease. Koskinen LL, Einarsdottir E, Dukes E, Heap GA, Dubois P, Korponay-Szabo IR, Kaukinen K, Kurppa K, Ziberna F, Vatta S, Not T, Ventura A, Sistonen P, Adany R, Pocsai Z, Szeles G, Maki M, Kere J, Wijmenga C, van Heel DA, Saavalainen P.Hum Mol Genet. 2009 Mar 15;18(6):1148-55. Epub 2008 Dec 22.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
65.4kDa (576aa) 70-100KDa (SDS-PAGE under reducing conditions.)
NCBI Official Full Name
interleukin-18 receptor accessory protein
NCBI Official Synonym Full Names
interleukin 18 receptor accessory protein
NCBI Official Symbol
IL18RAP
NCBI Official Synonym Symbols
ACPL; CD218b; IL-1R7; IL18RB; CDw218b; IL-1R-7; IL-18RAcP; IL-1RAcPL; IL-18Rbeta; IL-18R-beta
NCBI Protein Information
interleukin-18 receptor accessory protein
UniProt Protein Name
Interleukin-18 receptor accessory protein
UniProt Gene Name
IL18RAP
UniProt Synonym Gene Names
IL1R7; IL-18 receptor accessory protein; IL-18RAcP; AcPL; IL-1RAcPL; IL-1R-7; IL-1R7; IL-18R-beta; IL-18Rbeta
UniProt Entry Name
I18RA_HUMAN

NCBI Description

The protein encoded by this gene is an accessory subunit of the heterodimeric receptor for interleukin 18 (IL18), a proinflammatory cytokine involved in inducing cell-mediated immunity. This protein enhances the IL18-binding activity of the IL18 receptor and plays a role in signaling by IL18. Mutations in this gene are associated with Crohn's disease and inflammatory bowel disease, and susceptibility to celiac disease and leprosy. Alternatively spliced transcript variants of this gene have been described, but their full-length nature is not known. [provided by RefSeq, Feb 2014]

Uniprot Description

IL18RAP: Required for the high affinity binding of interleukin 18 (IL-18) to its receptor complex. Together with IL18R1 mediates IL-18-dependent activation of NF-kappa-B and JNK. Belongs to the interleukin-1 receptor family.

Protein type: Cell surface; Membrane protein, integral

Chromosomal Location of Human Ortholog: 2q12

Cellular Component: integral to membrane

Molecular Function: receptor activity

Biological Process: cell surface receptor linked signal transduction; immune response; inflammatory response

Research Articles on IL18RAP

Similar Products

Product Notes

The IL18RAP il18rap (Catalog #AAA6147756) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The IL18RAP (Interleukin-18 Receptor Accessory Protein, IL-18 Receptor Accessory Protein, IL-18RAcP, Accessory Protein-like, AcPL, CD218 Antigen-like Family Member B, CDw218b, IL-1R Accessory Protein-like, IL-1RAcPL, Interleukin-1 Receptor 7, IL-1R-7, IL-1R7, reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's IL18RAP can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the IL18RAP il18rap for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "IL18RAP, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.