Mouse IKBKB Monoclonal Antibody | anti-IKBKB antibody

IKBKB (Inhibitor of kappa Light Polypeptide Gene Enhancer in B-Cells, Kinase beta, FLJ40509, IKK-beta, IKK2, IKKB, MGC131801, NFKBIKB) (PE)

Cat. Num. AAA6184944

• Gene Names: IKBKB; IKK2; IKKB; IMD15; IMD15A; IMD15B; NFKBIKB; IKK-beta
• Applications: Western Blot
• Purity: Purified
• Synonyms: IKBKB; Monoclonal Antibody; IKBKB (Inhibitor of kappa Light Polypeptide Gene Enhancer in B-Cells; Kinase beta; FLJ40509; IKK-beta; IKK2; IKKB; MGC131801; NFKBIKB) (PE); Inhibitor of kappa Light Polypeptide Gene Enhancer in B-Cells; NFKBIKB; anti-IKBKB antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 2F4
• Specificity: Recognizes IKBKB.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
• Sequence Length: 256

• Applicable Applications for anti-IKBKB antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: IKBKB (AAH06231, 3aa-120aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: WSPSLTTQTCGAWEMKERLGTGGFGNVIRWHNQETGEQIAIKQCRQELSPRNRERWCLEIQIMRRLTHPNVVAARDVPEGMQNLAPNDLPLLAMEYCQGGDLRKYLNQFENCCGLREG
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged IKBKB is approximately 0.03ng/ml as a capture antibody.)

Related Product Information for anti-IKBKB antibody

NFKB1 (MIM 164011) or NFKB2 (MIM 164012) is bound to REL (MIM 164910), RELA (MIM 164014), or RELB (MIM 604758) to form the NFKB complex. The NFKB complex is inhibited by I-kappa-B proteins (NFKBIA, MIM 164008, or NFKBIB, MIM 604495), which inactivate NF-kappa-B by trapping it in the cytoplasm. Phosphorylation of serine residues on the I-kappa-B proteins by kinases (IKBKA, MIM 600664, or IKBKB) marks them for destruction via the ubiquitination pathway, thereby allowing activation of the NF-kappa-B complex. Activated NFKB complex translocates into the nucleus and binds DNA at kappa-B-binding motifs such as 5-prime GGGRNNYYCC 3-prime or 5-prime HGGARNYYCC 3-prime (where H is A, C, or T; R is an A or G purine; and Y is a C or T pyrimidine). [supplied by OMIM]

Product Categories/Family for anti-IKBKB antibody

Antibodies; Protein Kinase Inhibitors

NCBI and Uniprot Product Information

• NCBI GI #: 13623263
• NCBI GeneID: 3551
• NCBI Official Full Name: IKBKB protein
• NCBI Official Synonym Full Names: inhibitor of nuclear factor kappa B kinase subunit beta
• NCBI Official Symbol: IKBKB
• NCBI Official Synonym Symbols: IKK2; IKKB; IMD15; IMD15A; IMD15B; NFKBIKB; IKK-beta
• NCBI Protein Information: inhibitor of nuclear factor kappa-B kinase subunit beta

NCBI Description

The protein encoded by this gene phosphorylates the inhibitor in the inhibitor/NF-kappa-B complex, causing dissociation of the inhibitor and activation of NF-kappa-B. The encoded protein itself is found in a complex of proteins. Several transcript variants, some protein-coding and some not, have been found for this gene. [provided by RefSeq, Sep 2011]