Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-ACTN2 Antibody Titration: 0.625ug/mlELISA Titer: 1:312500Positive Control: Human Muscle)

Rabbit ACTN2 Polyclonal Antibody | anti-ACTN2 antibody

ACTN2 antibody - C-terminal region

Gene Names
Actn2; 1110008F24Rik
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Protein A purified
Synonyms
ACTN2; Polyclonal Antibody; ACTN2 antibody - C-terminal region; anti-ACTN2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: IQSYSIRISSSNPYSTVTMDELRNKWDKVKQLVPVRDQSLQEELARQHAN
Sequence Length
894
Applicable Applications for anti-ACTN2 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 93%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 83%
Immunogen
The immunogen is a synthetic peptide corresponding to a region of Mouse
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-ACTN2 Antibody Titration: 0.625ug/mlELISA Titer: 1:312500Positive Control: Human Muscle)

Western Blot (WB) (WB Suggested Anti-ACTN2 Antibody Titration: 0.625ug/mlELISA Titer: 1:312500Positive Control: Human Muscle)
Related Product Information for anti-ACTN2 antibody
This is a rabbit polyclonal antibody against ACTN2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The alpha-actinins are a multigene family of four actin-binding proteins related to dystrophin. The two skeletal muscle isoforms of alpha-actinin (ACTN2 and ACTN3) are major structural components of the Z-line involved in anchoring the actin-containing thin filaments. In humans, ACTN2 is expressed in all muscle fibres, while ACTN3 expression is restricted to a subset of type 2 fibres. Murine Actn2 and Actn3 are differentially expressed, spatially and temporally, during embryonic development and, in contrast to humans, alpha-actinin-2 expression does not completely overlap alpha-actinin-3 in postnatal skeletal muscle, suggesting independent function.
Product Categories/Family for anti-ACTN2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
98kDa
NCBI Official Full Name
alpha-actinin-2
NCBI Official Synonym Full Names
actinin alpha 2
NCBI Official Symbol
Actn2
NCBI Official Synonym Symbols
1110008F24Rik
NCBI Protein Information
alpha-actinin-2
UniProt Protein Name
Alpha-actinin-2
Protein Family
UniProt Gene Name
Actn2
UniProt Entry Name
ACTN2_MOUSE

Uniprot Description

ACTN2: F-actin cross-linking protein which is thought to anchor actin to a variety of intracellular structures. This is a bundling protein. Defects in ACTN2 are the cause of cardiomyopathy dilated type 1AA (CMD1AA). Dilated cardiomyopathy is a disorder characterized by ventricular dilation and impaired systolic function, resulting in congestive heart failure and arrhythmia. Patients are at risk of premature death. Belongs to the alpha-actinin family.

Protein type: Cytoskeletal; Motility/polarity/chemotaxis

Cellular Component: sarcomere; cortical actin cytoskeleton; focal adhesion; cytoplasm; Z disc; striated muscle thin filament; filopodium

Molecular Function: protein binding, bridging; actin filament binding; protein dimerization activity; identical protein binding; LIM domain binding; protein binding; protein homodimerization activity; ligand-dependent nuclear receptor transcription coactivator activity; metal ion binding; cytoskeletal protein binding; titin binding; calcium ion binding; actin binding; FATZ binding; thyroid hormone receptor coactivator activity

Biological Process: focal adhesion formation; regulation of membrane potential; muscle contraction; negative regulation of potassium ion transport; microspike biogenesis; positive regulation of potassium ion transport; protein homotetramerization

Research Articles on ACTN2

Similar Products

Product Notes

The ACTN2 actn2 (Catalog #AAA3203585) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ACTN2 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's ACTN2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ACTN2 actn2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: IQSYSIRISS SNPYSTVTMD ELRNKWDKVK QLVPVRDQSL QEELARQHAN. It is sometimes possible for the material contained within the vial of "ACTN2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.