Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37kD).)

Mouse anti-Human IGFN1 Monoclonal Antibody | anti-IGFN1 antibody

IGFN1 (Immunoglobulin-like and Fibronectin Type III Domain-containing Protein 1, EEF1A2-binding Protein 1, KY-interacting Protein 1, EEF1A2BP1, KYIP1, DKFZp434B1231)

Gene Names
IGFN1; EEF1A2BP1
Reactivity
Human
Applications
ELISA, Western Blot, Immunofluorescence
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
IGFN1; Monoclonal Antibody; IGFN1 (Immunoglobulin-like and Fibronectin Type III Domain-containing Protein 1; EEF1A2-binding Protein 1; KY-interacting Protein 1; EEF1A2BP1; KYIP1; DKFZp434B1231); Anti -IGFN1 (Immunoglobulin-like and Fibronectin Type III Domain-containing Protein 1; anti-IGFN1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
5B12
Specificity
Recognizes human DKFZp434B1231.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
GILPGHEYHFRVVAKNELGASKPSDTSQPWCIPRQRDRFTVKAPCYREPDLSQKPRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEGNP
Applicable Applications for anti-IGFN1 antibody
ELISA (EL/EIA), Western Blot (WB), Immunofluorescence (IF)
Application Notes
Suitable for use in Immunofluorescence, ELISA and Western Blot.
Dilution: Immunofluorescence: 15ug/ml
Immunogen
Partial recombinant corresponding to aa720-819 from human DKFZp434B1231 (NP_840059) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37kD).)

Western Blot (WB)

(DKFZp434B1231 monoclonal antibody, Western Blot analysis of DKFZp434B1231 expression in A-431.)

Western Blot (WB) (DKFZp434B1231 monoclonal antibody, Western Blot analysis of DKFZp434B1231 expression in A-431.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to DKFZp434B1231 on HeLa cell. [antibody concentration 15ug/ml].)

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to DKFZp434B1231 on HeLa cell. [antibody concentration 15ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged DKFZp434B1231 is ~0.03ng/ml as a capture antibody)

Testing Data (Detection limit for recombinant GST tagged DKFZp434B1231 is ~0.03ng/ml as a capture antibody)
Related Product Information for anti-IGFN1 antibody
Interacts with FLNC. Interacts with KY.
Product Categories/Family for anti-IGFN1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
137,763 Da
NCBI Official Full Name
immunoglobulin-like and fibronectin type III domain-containing protein 1
NCBI Official Synonym Full Names
immunoglobulin-like and fibronectin type III domain containing 1
NCBI Official Symbol
IGFN1
NCBI Official Synonym Symbols
EEF1A2BP1
NCBI Protein Information
immunoglobulin-like and fibronectin type III domain-containing protein 1; eEF1A2 binding protein; EEF1A2-binding protein 1; KY-interacting protein 1
UniProt Protein Name
Immunoglobulin-like and fibronectin type III domain-containing protein 1
UniProt Gene Name
IGFN1
UniProt Synonym Gene Names
EEF1A2BP1; KYIP1
UniProt Entry Name
IGFN1_HUMAN

Uniprot Description

IGFN1: 4 isoforms of the human protein are produced by alternative splicing.

Chromosomal Location of Human Ortholog: 1q32.1

Cellular Component: nucleus; Z disc

Research Articles on IGFN1

Similar Products

Product Notes

The IGFN1 igfn1 (Catalog #AAA6007056) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The IGFN1 (Immunoglobulin-like and Fibronectin Type III Domain-containing Protein 1, EEF1A2-binding Protein 1, KY-interacting Protein 1, EEF1A2BP1, KYIP1, DKFZp434B1231) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's IGFN1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB), Immunofluorescence (IF). Suitable for use in Immunofluorescence, ELISA and Western Blot. Dilution: Immunofluorescence: 15ug/ml. Researchers should empirically determine the suitability of the IGFN1 igfn1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: GILPGHEYHF RVVAKNELGA SKPSDTSQPW CIPRQRDRFT VKAPCYREPD LSQKPRFLVG LRSHLLPQGC ECCMSCAVQG SPRPHVTWFK NDRSLEGNP. It is sometimes possible for the material contained within the vial of "IGFN1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.