Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (43kD).)

Mouse anti-Human IFT20 Monoclonal Antibody | anti-IFT20 antibody

IFT20 (Intraflagellar Transport Protein 20 Homolog) (PE)

Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
IFT20; Monoclonal Antibody; IFT20 (Intraflagellar Transport Protein 20 Homolog) (PE); anti-IFT20 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3F3
Specificity
Recognizes human IFT20.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Sequence Length
148
Applicable Applications for anti-IFT20 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-148 from human IFT20 (NP_777547) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MAKDILGEAGLHFDELNKLRVLDPEVTQQTIELKEECKDFVDKIGQFQKIVGGLIELVDQLAKEAENEKMKSLAVSPRLECTGAISAHCKLCLSDSSDSPTSPSRVGGTTGHRCSELAQIYSKAERSSTAATSSPNSRKENAARKVSG
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (43kD).)

Western Blot (WB) (Western Blot detection against Immunogen (43kD).)

Western Blot (WB)

(Western Blot analysis of IFT20 expression in transfected 293T cell line by IFT20 monoclonal antibody. Lane 1: IFT20 transfected lysate (16kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of IFT20 expression in transfected 293T cell line by IFT20 monoclonal antibody. Lane 1: IFT20 transfected lysate (16kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged IFT20 is 0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged IFT20 is 0.1ng/ml as a capture antibody.)
Related Product Information for anti-IFT20 antibody
IFT20 is part of intraflagellar transport (IFT) particles involved in ciliary process assembly. IFT20 may play a role in the trafficking of ciliary membrane proteins from the Golgi complex to the cilium.
Product Categories/Family for anti-IFT20 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
intraflagellar transport protein 20 homolog isoform 2
NCBI Official Synonym Full Names
intraflagellar transport 20
NCBI Official Symbol
IFT20
NCBI Protein Information
intraflagellar transport protein 20 homolog
UniProt Protein Name
Intraflagellar transport protein 20 homolog
UniProt Gene Name
IFT20
UniProt Synonym Gene Names
hIFT20
UniProt Entry Name
IFT20_HUMAN

NCBI Description

This gene encodes a intraflagellar transport protein important for intracellular transport. The encoded protein forms part of a complex involved in trafficking of proteins from the Golgi body, including recycling of immune signalling components (Finetti et al., PubMed: 19855387). This gene is part of a complex set of sense-antisense loci that may be co-regulated. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. A pseudogene of this gene is located on the long arm of chromosome 14.[provided by RefSeq, Jun 2012]

Uniprot Description

IFT20: Part of intraflagellar transport (IFT) particles involved in ciliary process assembly. May play a role in the trafficking of ciliary membrane proteins from the Golgi complex to the cilium. 3 isoforms of the human protein are produced by alternative splicing.

Chromosomal Location of Human Ortholog: 17q11.2

Cellular Component: centriole; microtubule cytoskeleton; Golgi membrane; Golgi apparatus; centrosome; photoreceptor outer segment; photoreceptor connecting cilium; cilium

Molecular Function: protein binding; opsin binding

Biological Process: smoothened signaling pathway; centrosome localization; organelle organization and biogenesis; protein localization in Golgi apparatus; intraflagellar transport; cilium biogenesis; visual learning; kidney development; cardiac muscle cell differentiation

Research Articles on IFT20

Similar Products

Product Notes

The IFT20 ift20 (Catalog #AAA6158338) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The IFT20 (Intraflagellar Transport Protein 20 Homolog) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's IFT20 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the IFT20 ift20 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "IFT20, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.