Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against immunogen (40.74kD).)

Mouse anti-Human IFITM3 Monoclonal Antibody | anti-IFITM3 antibody

IFITM3 (Interferon-induced Transmembrane Protein 3, Dispanin Subfamily A Member 2b, DSPA2b, Interferon-inducible Protein 1-8U) (MaxLight 490)

Gene Names
IFITM3; 1-8U; IP15; DSPA2b
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
IFITM3; Monoclonal Antibody; IFITM3 (Interferon-induced Transmembrane Protein 3; Dispanin Subfamily A Member 2b; DSPA2b; Interferon-inducible Protein 1-8U) (MaxLight 490); anti-IFITM3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
4C8-1B10
Specificity
Recognizes human IFITM3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight490.
Sequence Length
637
Applicable Applications for anti-IFITM3 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant protein corresponding to aa1-133 from human IFITM3 with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MNHTVQTFFSPVNSGQPPNYEMLKEEHEVAVLGAPHNPAPPTSTVIHIRSETSVP DHVVWSLFNTLFMNPCCLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGILMTILLIVIPVLIFQAYG
Conjugate
MaxLight490
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against immunogen (40.74kD).)

Western Blot (WB) (Western Blot detection against immunogen (40.74kD).)

Western Blot (WB)

(Western Blot analysis of IFITM3 expression in Hela using.)

Western Blot (WB) (Western Blot analysis of IFITM3 expression in Hela using.)

Testing Data

(Detection limit for is ~0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for is ~0.3ng/ml as a capture antibody.)
Product Categories/Family for anti-IFITM3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
Homo sapiens interferon induced transmembrane protein 3 (1-8U), mRNA
NCBI Official Synonym Full Names
interferon induced transmembrane protein 3
NCBI Official Symbol
IFITM3
NCBI Official Synonym Symbols
1-8U; IP15; DSPA2b
NCBI Protein Information
interferon-induced transmembrane protein 3

NCBI Description

The protein encoded by this gene is an interferon-induced membrane protein that helps confer immunity to influenza A H1N1 virus, West Nile virus, and dengue virus. Two transcript variants, only one of them protein-coding, have been found for this gene. Another variant encoding an N-terminally truncated isoform has been reported, but the full-length nature of this variant has not been determined. [provided by RefSeq, May 2012]

Research Articles on IFITM3

Similar Products

Product Notes

The IFITM3 (Catalog #AAA6201349) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The IFITM3 (Interferon-induced Transmembrane Protein 3, Dispanin Subfamily A Member 2b, DSPA2b, Interferon-inducible Protein 1-8U) (MaxLight 490) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's IFITM3 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the IFITM3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "IFITM3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.