Rabbit anti-Human IFITM3 Polyclonal Antibody | anti-IFITM3 antibody

IFITM3 (Interferon-induced Transmembrane Protein 3, Dispanin Subfamily A Member 2b, DSPA2b, Interferon-inducible Protein 1-8U) APC

Cat. Num. AAA6382190

• Gene Names: IFITM3; 1-8U; IP15; DSPA2b
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: IFITM3; Polyclonal Antibody; IFITM3 (Interferon-induced Transmembrane Protein 3; Dispanin Subfamily A Member 2b; DSPA2b; Interferon-inducible Protein 1-8U) APC; anti-IFITM3 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human IFITM3.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
• Sequence Length: 808

• Applicable Applications for anti-IFITM3 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full-length human IFITM3, aa1-133 (NP_066362.1).
• Immunogen Sequence: MSHTVQTFFSPVNSGQPPNYEMLKEEHEVAVLGGPHNPAPPTSTVIHIRSETSVPDHVVWSLFNTLFMNPCCLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGILMTILLIVIPVLIFQAYG
• Conjugate: APC
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(IFITM3 rabbit polyclonal antibody. Western Blot analysis of IFITM3 expression in human placenta.)

Western Blot (WB)

(IFITM3 rabbit polyclonal antibody. Western Blot analysis of IFITM3 expression in HepG2.)

Western Blot (WB)

(Western Blot analysis of IFITM3 expression in transfected 293T cell line by IFITM3 polyclonal antibody. Lane 1: IFITM3 transfected lysate (14.6kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-IFITM3 antibody

FITM3 is a 14.6kD (predicted) member of the CD225 family of proteins. It is expressed on primordial germ cells and select tumor types, and appears to regulate cell migration. Human IFITM3 is a 133aa, two-transmembrene protein that contains an N-terminal aa1-57 and a C-terminal aa108-128 extracellular domain. Over aa3-57, human IFITM3 is 59% and 56% aa identical to bovine and mouse IFITM3, respectively. Over aa3-57 human IFITM3 is 88% identical to human IFITM2.

Product Categories/Family for anti-IFITM3 antibody

Antibodies; Interferon

NCBI and Uniprot Product Information

• NCBI GI #: 11995467
• NCBI GeneID: 10410
• NCBI Accession #: NM_021034.1
• NCBI GenBank Nucleotide #: NM_021034.1
• NCBI Official Full Name: Homo sapiens interferon induced transmembrane protein 3 (1-8U) (IFITM3), mRNA
• NCBI Official Synonym Full Names: interferon induced transmembrane protein 3
• NCBI Official Symbol: IFITM3
• NCBI Official Synonym Symbols: 1-8U; IP15; DSPA2b
• NCBI Protein Information: interferon-induced transmembrane protein 3
• Protein Family: Interferon-induced transmembrane protein

NCBI Description

The protein encoded by this gene is an interferon-induced membrane protein that helps confer immunity to influenza A H1N1 virus, West Nile virus, and dengue virus. Two transcript variants, only one of them protein-coding, have been found for this gene. Another variant encoding an N-terminally truncated isoform has been reported, but the full-length nature of this variant has not been determined. [provided by RefSeq, May 2012]