Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged ICA1 is ~0.3ng/ml using 128184 as a capture antibody.)

Mouse anti-Human ICA1 Monoclonal Antibody | anti-ICA1 antibody

ICA1 (Islet Cell Autoantigen 1, 69kD Islet Cell Autoantigen, ICA69, Islet Cell Autoantigen p69, ICAp69, p69) APC

Gene Names
ICA1; ICA69; ICAp69
Reactivity
Human
Applications
Western Blot
Purity
Purified
Synonyms
ICA1; Monoclonal Antibody; ICA1 (Islet Cell Autoantigen 1; 69kD Islet Cell Autoantigen; ICA69; Islet Cell Autoantigen p69; ICAp69; p69) APC; anti-ICA1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
6G11
Specificity
Recognizes human ICA1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-ICA1 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa1-110 from human ICA1 with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MSGHKCSYPWDLQDRYAQDKSVVNKMQQKYWETKQAFIKATGKKEDEHVVASDADLDAKLELFHSIQRTCLDLSKAIVLYQKRICFLSQEENELGKFLRSQGFQDKTRAG
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged ICA1 is ~0.3ng/ml using 128184 as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged ICA1 is ~0.3ng/ml using 128184 as a capture antibody.)

Western Blot (WB)

(Western Blot detection against Immunogen using 128184 (37.84kD).)

Western Blot (WB) (Western Blot detection against Immunogen using 128184 (37.84kD).)
Product Categories/Family for anti-ICA1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
53kDa
NCBI Official Full Name
islet cell autoantigen 1 isoform a
NCBI Official Synonym Full Names
islet cell autoantigen 1
NCBI Official Symbol
ICA1
NCBI Official Synonym Symbols
ICA69; ICAp69
NCBI Protein Information
islet cell autoantigen 1
UniProt Protein Name
Islet cell autoantigen 1
Protein Family
UniProt Gene Name
ICA1
UniProt Synonym Gene Names
ICA69; ICAp69; p69
UniProt Entry Name
ICA69_HUMAN

NCBI Description

This gene encodes a protein with an arfaptin homology domain that is found both in the cytosol and as membrane-bound form on the Golgi complex and immature secretory granules. This protein is believed to be an autoantigen in insulin-dependent diabetes mellitus and primary Sjogren's syndrome. Several transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Feb 2013]

Uniprot Description

ICA1: May play a role in neurotransmitter secretion.

Protein type: Unknown function

Chromosomal Location of Human Ortholog: 7p22

Cellular Component: cell junction; cytoplasm; cytosol; dendrite; Golgi apparatus; Golgi membrane; Golgi stack; perinuclear region of cytoplasm; secretory granule membrane; synaptic vesicle membrane

Molecular Function: protein binding; protein domain specific binding

Biological Process: neurotransmitter transport; regulation of insulin secretion; regulation of protein homodimerization activity

Research Articles on ICA1

Similar Products

Product Notes

The ICA1 ica1 (Catalog #AAA6137093) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ICA1 (Islet Cell Autoantigen 1, 69kD Islet Cell Autoantigen, ICA69, Islet Cell Autoantigen p69, ICAp69, p69) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ICA1 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ICA1 ica1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ICA1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.