Mouse anti-Human HTRA2 Monoclonal Antibody | anti-HTRA2 antibody

HTRA2 (OMI, PRSS25, Serine Protease HTRA2, Mitochondrial, High Temperature Requirement Protein A2, Omi Stress-regulated Endoprotease, Serine Protease 25, Serine Proteinase OMI) (HRP)

Cat. Num. AAA6152994

• Gene Names: HTRA2; OMI; PARK13; PRSS25
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: HTRA2; Monoclonal Antibody; HTRA2 (OMI; PRSS25; Serine Protease HTRA2; Mitochondrial; High Temperature Requirement Protein A2; Omi Stress-regulated Endoprotease; Serine Protease 25; Serine Proteinase OMI) (HRP); anti-HTRA2 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 4F10
• Specificity: Recognizes human HTRA2.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-HTRA2 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa359-458 from human HTRA2 (AAH00096) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: RRYIGVMMLTLSPSILAELQLREPSFPDVQHGVLIHKVILGSPAHRAGLRPGDVILAIGEQMVQNAEDVYEAVRTQSQLAVQIRRGRETLTLYVTPEVTE
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37kD).)

Western Blot (WB)

(HTRA2 monoclonal antibody Western Blot analysis of HTRA2 expression in HeLa.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to HTRA2 on HeLa cell. [antibody concentration 30ug/ml])

Testing Data

(Detection limit for recombinant GST tagged HTRA2 is ~0.1ng/ml as a capture antibody.)

Related Product Information for anti-HTRA2 antibody

This gene encodes a serine protease. The protein has been localized in the endoplasmic reticulum and interacts with an alternatively spliced form of mitogen-activated protein kinase 14. The protein has also been localized to the mitochondria with release to the cytosol following apoptotic stimulus. The protein is thought to induce apoptosis by binding the apoptosis inhibitory protein baculoviral IAP repeat-containing 4. Nuclear localization of this protein has also been observed. Alternate splicing of this gene results in two transcript variants encoding different isoforms. Additional transcript variants have been described, but their full-length sequences have not been determined. [provided by RefSeq].

Product Categories/Family for anti-HTRA2 antibody

Antibodies; Enzymes; Peptidase

NCBI and Uniprot Product Information

• NCBI GI #: 34783037
• NCBI GeneID: 27429
• UniProt Accession #: O43464; Q9HBZ4; Q9P0Y3; Q9P0Y4
• Molecular Weight: 39,914 Da
• NCBI Official Full Name: Homo sapiens HtrA serine peptidase 2, mRNA
• NCBI Official Synonym Full Names: HtrA serine peptidase 2
• NCBI Official Symbol: HTRA2
• NCBI Official Synonym Symbols: OMI; PARK13; PRSS25
• NCBI Protein Information: serine protease HTRA2, mitochondrial
• UniProt Protein Name: Serine protease HTRA2, mitochondrial
• Protein Family: Serine protease
• UniProt Gene Name: HTRA2
• UniProt Synonym Gene Names: OMI; PRSS25; HtrA2
• UniProt Entry Name: HTRA2_HUMAN

NCBI Description

This gene encodes a serine protease. The protein has been localized in the endoplasmic reticulum and interacts with an alternatively spliced form of mitogen-activated protein kinase 14. The protein has also been localized to the mitochondria with release to the cytosol following apoptotic stimulus. The protein is thought to induce apoptosis by binding the apoptosis inhibitory protein baculoviral IAP repeat-containing 4. Nuclear localization of this protein has also been observed. Alternate splicing of this gene results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Mar 2016]

Uniprot Description

HTRA2: a serine proteinase that normally resides in mitochondrial membranes. It exists in two populations in mitochondria: as an unprocessed form probably attached to the inner mitochondrial membrane through a N-terminal transmembrane domain, and as a processed form containing a reaper motif at its N-terminus. Following apoptotic stimuli it is autoproteolytically activated and released into the cytosol, where it promotes programmed cell death in caspase-dependent and -independent manners. The amino-terminal reaper motif binds to the IAP (inhibitor of apoptosis) proteins cIAP1, cIAP2, and and XIAP, disrupting IAP-caspase complexes in a manner similar to Smac/DIABLO. Phosphorylation by the protein kinase Akt attenuates its serine protease and pro-apoptotic activities. The PDZ domain mediates interaction with Mxi2, an alternatively spliced form of the p38 stress-activated kinase. In contrast to its pro-apoptotic effects, targeted deletion in mice indicates that it is involved in protection against cell stress in striatial neurons. Defects in HTRA2 are the cause of Parkinson disease 13 (PARK13). Four alternatively spliced human isoforms have been described.

Protein type: Membrane protein, integral; EC 3.4.21.108; Mitochondrial; Protease

Chromosomal Location of Human Ortholog: 2p12

Cellular Component: endoplasmic reticulum membrane; internal side of plasma membrane; cytoskeleton; membrane; mitochondrion; endoplasmic reticulum; mitochondrial membrane; mitochondrial intermembrane space; cytosol; nucleus; chromatin

Molecular Function: peptidase activity; protein binding; serine-type peptidase activity; serine-type endopeptidase activity; unfolded protein binding

Biological Process: mitochondrion organization and biogenesis; positive regulation of apoptosis; regulation of multicellular organism growth; positive regulation of caspase activity; response to herbicide; proteolysis; adult walking behavior; negative regulation of cell cycle; protein autoprocessing; DNA damage response, signal transduction resulting in induction of apoptosis; pentacyclic triterpenoid metabolic process; cellular protein catabolic process; forebrain development; neuron development; ceramide metabolic process

Disease: Parkinson Disease 13, Autosomal Dominant, Susceptibility To