Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human HTR1E Monoclonal Antibody | anti-HTR1E antibody

HTR1E (5-hydroxytryptamine Receptor 1E, 5-HT-1E, 5-HT1E, S31, Serotonin Receptor 1E) (MaxLight 490)

Gene Names
HTR1E; 5-HT1E
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
HTR1E; Monoclonal Antibody; HTR1E (5-hydroxytryptamine Receptor 1E; 5-HT-1E; 5-HT1E; S31; Serotonin Receptor 1E) (MaxLight 490); anti-HTR1E antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2E9
Specificity
Recognizes human HTR1E.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight490.
Applicable Applications for anti-HTR1E antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa206-276 from human HTR1E (NP_000856.1) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
YHAAKSLYQKRGSSRHLSNRSTDSQNSFASCKLTQTFCVSDFSTSDPTTEFEKFHASIRIPPFDNDLDHPG
Conjugate
MaxLight490
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-HTR1E antibody
5HT1E, a Serotonin Receptor, is not well studied. It is classified as an 5-HT1-like receptor because of its ligand-binding and effector-coupling characteristics. The human 5-HT1E receptor has been studied in an African green monkey kidney cell line, in which it modulated cAMP levels upon binding serotonin. Lack of structural variants in the human gene indicate a highly conserved protein. The 5-HT1E receptor has been reported to be expressed in human cortex, caudate, putamen, and amygdala, as well as in dorsal root ganglia and in coronary artery. ESTs have been isolated from human brain cancer libraries.
Product Categories/Family for anti-HTR1E antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
41,682 Da
NCBI Official Full Name
5-hydroxytryptamine receptor 1E
NCBI Official Synonym Full Names
5-hydroxytryptamine (serotonin) receptor 1E, G protein-coupled
NCBI Official Symbol
HTR1E
NCBI Official Synonym Symbols
5-HT1E
NCBI Protein Information
5-hydroxytryptamine receptor 1E; S31; 5-HT-1E; serotonin receptor 1E
UniProt Protein Name
5-hydroxytryptamine receptor 1E
UniProt Gene Name
HTR1E
UniProt Synonym Gene Names
5-HT-1E; 5-HT1E
UniProt Entry Name
5HT1E_HUMAN

Uniprot Description

5-HT(1E): This is one of the several different receptors for 5- hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. The activity of this receptor is mediated by G proteins that inhibit adenylate cyclase activity. Belongs to the G-protein coupled receptor 1 family.

Protein type: Receptor, GPCR; Membrane protein, integral; GPCR, family 1; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 6q14-q15

Cellular Component: integral to plasma membrane; plasma membrane

Molecular Function: G-protein coupled receptor activity; serotonin binding; serotonin receptor activity

Biological Process: G-protein coupled receptor protein signaling pathway; synaptic transmission; G-protein signaling, coupled to cyclic nucleotide second messenger; negative regulation of cAMP metabolic process; G-protein signaling, adenylate cyclase inhibiting pathway; serotonin receptor signaling pathway

Research Articles on HTR1E

Similar Products

Product Notes

The HTR1E htr1e (Catalog #AAA6201319) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The HTR1E (5-hydroxytryptamine Receptor 1E, 5-HT-1E, 5-HT1E, S31, Serotonin Receptor 1E) (MaxLight 490) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's HTR1E can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the HTR1E htr1e for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HTR1E, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.