Mouse anti-Human HSPB8 Monoclonal Antibody | anti-HSPB8 antibody

HSPB8 (Heat Shock Protein beta-8, HspB8, Alpha-crystallin C Chain, E2-induced Gene 1 Protein, Protein Kinase H11, Small Stress Protein-like Protein HSP22, CRYAC, E2IG1, HSP22, PP1629) APC

Cat. Num. AAA6137075

• Gene Names: HSPB8; H11; HMN2; CMT2L; DHMN2; E2IG1; HMN2A; HSP22
• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: HSPB8; Monoclonal Antibody; HSPB8 (Heat Shock Protein beta-8; HspB8; Alpha-crystallin C Chain; E2-induced Gene 1 Protein; Protein Kinase H11; Small Stress Protein-like Protein HSP22; CRYAC; E2IG1; HSP22; PP1629) APC; anti-HSPB8 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG
• Clone Number: 5B12
• Specificity: Recognizes human HSPB8.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).

• Applicable Applications for anti-HSPB8 antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
• Application Notes: IHC-P: 3ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa97-197 from human HSPB8 (NP_055180) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: KVCVNVHSFKPEELMVKTKDGYVEVSGKHEEKQQEGGIVSKNFTKKIQLPAEVDPVTVFASLSPEGLLIIEAPQVPPYSTFGESSFNNELPQDSQEVTCT*
• Conjugate: APC
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB)

(Western Blot analysis of HSPB8 expression in transfected 293T cell line by HSPB8 monoclonal antibody.. Lane 1: HSPB8 transfected lysate (35.446kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to HSPB8 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3ug/ml])

Testing Data

(Detection limit for recombinant GST tagged HSPB8 is ~3ng/ml as a capture antibody.)

Product Categories/Family for anti-HSPB8 antibody

Antibodies; Heat Shock Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 7657146
• NCBI GeneID: 26353
• NCBI Accession #: NP_055180
• NCBI GenBank Nucleotide #: NM_014365
• UniProt Accession #: Q9UJY1; Q6FIH3; Q9UKS3; B2R6A6
• Molecular Weight: 23.7 kDa (216aa), confirmed by MALDI-TOF.
• NCBI Official Full Name: heat shock protein beta-8
• NCBI Official Synonym Full Names: heat shock protein family B (small) member 8
• NCBI Official Symbol: HSPB8
• NCBI Official Synonym Symbols: H11; HMN2; CMT2L; DHMN2; E2IG1; HMN2A; HSP22
• NCBI Protein Information: heat shock protein beta-8
• UniProt Protein Name: Heat shock protein beta-8
• Protein Family: Heat shock protein
• UniProt Gene Name: HSPB8
• UniProt Synonym Gene Names: CRYAC; E2IG1; HSP22; HspB8
• UniProt Entry Name: HSPB8_HUMAN

NCBI Description

The protein encoded by this gene belongs to the superfamily of small heat-shock proteins containing a conservative alpha-crystallin domain at the C-terminal part of the molecule. The expression of this gene in induced by estrogen in estrogen receptor-positive breast cancer cells, and this protein also functions as a chaperone in association with Bag3, a stimulator of macroautophagy. Thus, this gene appears to be involved in regulation of cell proliferation, apoptosis, and carcinogenesis, and mutations in this gene have been associated with different neuromuscular diseases, including Charcot-Marie-Tooth disease. [provided by RefSeq, Jul 2008]

Uniprot Description

HSPB8: Displays temperature-dependent chaperone activity. Monomer. Interacts with HSPB1. Interacts with DNAJB6. By 17-beta-estradiol. Predominantly expressed in skeletal muscle and heart. Belongs to the small heat shock protein (HSP20) family.

Protein type: Heat shock protein

Chromosomal Location of Human Ortholog: 12q24.23

Cellular Component: nucleoplasm; Golgi apparatus; cytoplasm; intracellular; nucleus

Molecular Function: identical protein binding; protein binding; protein kinase activity

Disease: Charcot-marie-tooth Disease, Axonal, Type 2l; Neuronopathy, Distal Hereditary Motor, Type Iia