Western Blot (WB)
(Western blot-PRPSAP2 Polyclonal Antibody)
Rabbit anti-Mouse PRPSAP2 Polyclonal Antibody | anti-PRPSAP2 antibody
PRPSAP2 Polyclonal Antibody
Gene Names
PRPSAP2; PAP41
Reactivity
Mouse
Applications
Western Blot
Purity
Affinity Purification
Synonyms
PRPSAP2; Polyclonal Antibody; PRPSAP2 Polyclonal Antibody; PAP41; phosphoribosyl pyrophosphate synthase-associated protein 2; anti-PRPSAP2 antibody
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Concentration
2.7 mg/ml (varies by lot)
Sequence Length
369
Applicable Applications for anti-PRPSAP2 antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human PRPSAP2 (NP_002758.1).
Immunogen Sequence
MFCVTPPELETKMNITKGGLVLFSANSNSSCMELSKKIAERLGVEMGKVQVYQEPNRETRVQIQESVRGKDVFIIQTVSKDVNTTIMELL
Positive Samples
Mouse Heart, Mouse Liver
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
Western Blot (WB)
(Western blot-PRPSAP2 Polyclonal Antibody)
Western Blot (WB)
(Western blot-PRPSAP2 Polyclonal Antibody)
Related Product Information for anti-PRPSAP2 antibody
This gene encodes a protein that associates with the enzyme phosphoribosylpyrophosphate synthetase (PRS). PRS catalyzes the formation of phosphoribosylpyrophosphate which is a substrate for synthesis of purine and pyrimidine nucleotides, histidine, tryptophan and NAD. PRS exists as a complex with two catalytic subunits and two associated subunits. This gene encodes a non-catalytic associated subunit of PRS. Alternate splicing results in multiple transcript variants.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 31kDa; 35kDa; 36kDa; 40kDa
Observed: 42kDa
Observed: 42kDa
NCBI Official Full Name
phosphoribosyl pyrophosphate synthase-associated protein 2 isoform 1
NCBI Official Synonym Full Names
phosphoribosyl pyrophosphate synthetase associated protein 2
NCBI Official Symbol
PRPSAP2
NCBI Official Synonym Symbols
PAP41
NCBI Protein Information
phosphoribosyl pyrophosphate synthase-associated protein 2
UniProt Protein Name
Phosphoribosyl pyrophosphate synthase-associated protein 2
Protein Family
UniProt Gene Name
PRPSAP2
UniProt Synonym Gene Names
PRPP synthase-associated protein 2; PAP41
NCBI Description
This gene encodes a protein that associates with the enzyme phosphoribosylpyrophosphate synthetase (PRS). PRS catalyzes the formation of phosphoribosylpyrophosphate which is a substrate for synthesis of purine and pyrimidine nucleotides, histidine, tryptophan and NAD. PRS exists as a complex with two catalytic subunits and two associated subunits. This gene encodes a non-catalytic associated subunit of PRS. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Sep 2011]
Uniprot Description
Seems to play a negative regulatory role in 5-phosphoribose 1-diphosphate synthesis.
Similar Products
Product Notes
The PRPSAP2 prpsap2 (Catalog #AAA9140443) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PRPSAP2 Polyclonal Antibody reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's PRPSAP2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the PRPSAP2 prpsap2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PRPSAP2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
