Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (67.43kD).)

Mouse anti-Human HPN Monoclonal Antibody | anti-HPN antibody

HPN (TMPRSS1, Serine Protease Hepsin, Transmembrane Protease Serine 1, Serine Protease Hepsin Non-catalytic Chain, Serine Protease Hepsin Catalytic Chain) (Biotin)

Gene Names
HPN; TMPRSS1
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
HPN; Monoclonal Antibody; HPN (TMPRSS1; Serine Protease Hepsin; Transmembrane Protease Serine 1; Serine Protease Hepsin Non-catalytic Chain; Serine Protease Hepsin Catalytic Chain) (Biotin); anti-HPN antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2D5
Specificity
Recognizes human HPN.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-HPN antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa40-417 from human HPN (AAH25716.1) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
VAVLLRSDQEPLYPVQVSSADARLMVFDKTEGTWRLLCSSRSNARVAGLSCEEMGFLRALTHSELDVRTAGANGTSGFFCVDEGRLPHTQRLLEVISVCDCPRGRFLAAICQDCGRRKLPVDRIVGGRDTSLGRWPWQVSLRYDGAHLCGGSLLSGDWVLTAAHCFPERNRVLSRWRVFAGAVAQASPHGLQLGVQAVVYHGGYLPFRDPNSEENSNDIALVHLSSPLPLTEYIQPVCLPAAGQALVDGKICTVTGWGNTQYYGQQAGVLQEARVPIISNDVCNGADFYGNQIKPKMFCAGYPEGGIDACQGDSGGPFACEDSISRTPRWRLCGIVSWGTGCALAQKPGVYTKVSDFREWIFQAIKTHSEASGMVTQL
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (67.43kD).)

Western Blot (WB) (Western Blot detection against Immunogen (67.43kD).)
Related Product Information for anti-HPN antibody
HPN is a type II transmembrane serine protease. This protein has an extracellular region that consists of two domains, a catalytic serine protease domain and a non-catalytic scavenger receptor cysteine-rich domain. This protein may be involved in diverse cellular functions including blood coagulation, maintenance of cell morphology and the growth and progression of certain cancers, particularly prostate cancer.
Product Categories/Family for anti-HPN antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
45,011 Da
NCBI Official Full Name
Homo sapiens hepsin, mRNA
NCBI Official Synonym Full Names
hepsin
NCBI Official Symbol
HPN
NCBI Official Synonym Symbols
TMPRSS1
NCBI Protein Information
serine protease hepsin

NCBI Description

This gene encodes a type II transmembrane serine protease that may be involved in diverse cellular functions, including blood coagulation and the maintenance of cell morphology. Expression of the encoded protein is associated with the growth and progression of cancers, particularly prostate cancer. The protein is cleaved into a catalytic serine protease chain and a non-catalytic scavenger receptor cysteine-rich chain, which associate via a single disulfide bond. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2013]

Research Articles on HPN

Similar Products

Product Notes

The HPN (Catalog #AAA6142350) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The HPN (TMPRSS1, Serine Protease Hepsin, Transmembrane Protease Serine 1, Serine Protease Hepsin Non-catalytic Chain, Serine Protease Hepsin Catalytic Chain) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's HPN can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the HPN for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HPN, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.