Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (C2orf30 antibody (MBS839780) used at 1 ug/ml to detect target protein.)

Rabbit C2orf30 Polyclonal Antibody | anti-C2orf30 antibody

C2orf30 antibody

Gene Names
ERLEC1; CIM; HEL117; XTP3-B; C2orf30; CL24936; CL25084; XTP3TPB
Applications
Western Blot
Purity
Affinity purified
Synonyms
C2orf30; Polyclonal Antibody; C2orf30 antibody; Polyclonal C2orf30; Anti-C2orf30; CL24936; XTP3TPB; Chromosome ORF 2; Chromosome ORF-2; Endoplasmic Reticulum Lectin 1; CL25084; Chromosome 2 ORF; anti-C2orf30 antibody
Ordering
For Research Use Only!
Host
Rabbit
Clonality
Polyclonal
Specificity
C2orf30 antibody was raised against the middle region of C2orf30
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C2orf30 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
429
Applicable Applications for anti-C2orf30 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
C2orf30 is a probable lectin that binds selectively to improperly folded lumenal proteins. May function in endoplasmic reticulum quality control and endoplasmic reticulum-associated degradation (ERAD) of both non-glycosylated proteins and glycoproteins.
Cross-Reactivity
Human
Immunogen
C2orf30 antibody was raised using the middle region of C2orf30 corresponding to a region with amino acids GKHVHQYHEDKDSGKTSVVVGTWNQEEHIEWAKKNTARAYHLQDDGTQTV
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(C2orf30 antibody (MBS839780) used at 1 ug/ml to detect target protein.)

Western Blot (WB) (C2orf30 antibody (MBS839780) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-C2orf30 antibody
Rabbit polyclonal C2orf30 antibody raised against the middle region of C2orf30
Product Categories/Family for anti-C2orf30 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
55 kDa (MW of target protein)
NCBI Official Full Name
C2orf30 protein
NCBI Official Synonym Full Names
endoplasmic reticulum lectin 1
NCBI Official Symbol
ERLEC1
NCBI Official Synonym Symbols
CIM; HEL117; XTP3-B; C2orf30; CL24936; CL25084; XTP3TPB
NCBI Protein Information
endoplasmic reticulum lectin 1
UniProt Protein Name
Endoplasmic reticulum lectin 1
UniProt Gene Name
ERLEC1
UniProt Synonym Gene Names
C2orf30; XTP3TPB; Erlectin
UniProt Entry Name
ERLEC_HUMAN

NCBI Description

This gene encodes a resident endoplasmic reticulum (ER) protein that functions in N-glycan recognition. This protein is thought to be involved in ER-associated degradation via its interaction with the membrane-associated ubiquitin ligase complex. It also functions as a regulator of multiple cellular stress-response pathways in a manner that promotes metastatic cell survival. Alternative splicing results in multiple transcript variants. A related pseudogene has been identified on chromosome 21. [provided by RefSeq, Aug 2011]

Uniprot Description

ERLEC1: Probable lectin that binds selectively to improperly folded lumenal proteins. May function in endoplasmic reticulum quality control and endoplasmic reticulum-associated degradation (ERAD) of both non-glycosylated proteins and glycoproteins. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 2p16.2

Cellular Component: endoplasmic reticulum lumen

Molecular Function: protein binding; glycoprotein binding

Biological Process: ER-associated protein catabolic process

Research Articles on C2orf30

Similar Products

Product Notes

The C2orf30 erlec1 (Catalog #AAA839780) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's C2orf30 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the C2orf30 erlec1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "C2orf30, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.