Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (34.1kD).)

Mouse anti-Human HOXD11 Monoclonal Antibody | anti-HOXD11 antibody

HOXD11 (HOX4F, Homeobox Protein Hox-D11, Homeobox Protein Hox-4F) (AP)

Gene Names
HOXD11; HOX4; HOX4F
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
HOXD11; Monoclonal Antibody; HOXD11 (HOX4F; Homeobox Protein Hox-D11; Homeobox Protein Hox-4F) (AP); anti-HOXD11 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
6C8
Specificity
Recognizes human HOXD11.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-HOXD11 antibody
ELISA (EIA), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-76 from human HOXD11 (NP_067015) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MNDFDECGQSAASMYLPGCAYYVAPSDFASKPSFLSQPSSCQMTFPYSSNLAPHVQPVREVAFRDYGLERAKWPYR
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (34.1kD).)

Western Blot (WB) (Western Blot detection against Immunogen (34.1kD).)

Western Blot (WB)

(HOXD11 monoclonal antibody Western Blot analysis of HOXD11 expression in K-562.)

Western Blot (WB) (HOXD11 monoclonal antibody Western Blot analysis of HOXD11 expression in K-562.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to HOXD11 on formalin-fixed paraffin-embedded human colon. [antibody concentration 0.7ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to HOXD11 on formalin-fixed paraffin-embedded human colon. [antibody concentration 0.7ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to HOXD11 on HeLa cell. [antibody concentration 10ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to HOXD11 on HeLa cell. [antibody concentration 10ug/ml])

Testing Data

(Detection limit for recombinant GST tagged HOXD11 is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged HOXD11 is ~0.03ng/ml as a capture antibody.)
Product Categories/Family for anti-HOXD11 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35kDa
NCBI Official Full Name
homeobox protein Hox-D11
NCBI Official Synonym Full Names
homeobox D11
NCBI Official Symbol
HOXD11
NCBI Official Synonym Symbols
HOX4; HOX4F
NCBI Protein Information
homeobox protein Hox-D11
Protein Family

NCBI Description

This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, located on different chromosomes, consisting of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXD genes located in a cluster on chromosome 2. Deletions that remove the entire HOXD gene cluster or the 5' end of this cluster have been associated with severe limb and genital abnormalities. The product of the mouse Hoxd11 gene plays a role in forelimb morphogenesis. [provided by RefSeq, Jul 2008]

Research Articles on HOXD11

Similar Products

Product Notes

The HOXD11 (Catalog #AAA6131736) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The HOXD11 (HOX4F, Homeobox Protein Hox-D11, Homeobox Protein Hox-4F) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's HOXD11 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the HOXD11 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HOXD11, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.