Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of ITGA2B using anti- ITGA2B antibody Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions. Lane 1: rat spleen tissue lysates, Lane 2: mouse spleen tissue lysates, After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti- ITGA2B antigen affinity purified polyclonal antibody at 0.5 ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for ITGA2B at approximately 125KD. The expected band size for ITGA2B is at 113KD.)

ITGA2B Polyclonal Antibody | anti-ITGA2B antibody

Anti-ITGA2B Antibody

Gene Names
ITGA2B; GT; GTA; CD41; GP2B; HPA3; CD41B; GPIIb; BDPLT2; BDPLT16; PPP1R93
Reactivity
Human, Mouse, Rat
Purity
Immunogen Affinity Purified
Synonyms
ITGA2B; Polyclonal Antibody; Anti-ITGA2B Antibody; Integrin alpha-Iib; antigen CD41; BDPLT16; BDPLT2; CD41; CD41B; form 2; GP2B; GPalpha IIb; GPIIb; GT; GTA; HPA3; Integrin alpha 2b; Integrin alpha IIb; Integrin alpha-IIb light chain; Integrin; alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex; antigen CD41); ITA2B_HUMAN; ITGAB; platelet fibrinogen receptor; alpha subunit; platelet glycoprotein IIb of IIb/IIIa complex; Platelet membrane glycoprotein IIb; platelet specific antigen BAK; integrin; anti-ITGA2B antibody
Ordering
For Research Use Only!
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Specificity
No cross reactivity with other proteins.
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
1039
Application Notes
Western Blot

Concencentration 0.1-0.5 ug/mL
Tested Species: Mouse , Rat
Predicted Species: Human


Immunohistochemistry (Paraffin –embedded section)

Concentration: 0.5-1 ug/mL
Tested Species: Human, Mouse, Rat
Antigen Retrieval : By Heat



Tested Species: In house tested species with positive results

Predicted Species: Species predicted to be fit for the product based on sequence similarities.

By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH 6.0 for 20 mins is required for the staining of formalin/paraffin sections.

Other applications have not been tested.

Optimal dilutions should be determined by end users.
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human ITGA2B (677-711aa EAELAVHLPQGAHYMRALSNVEGFERLICNQKKEN), different from the related mouse sequence by four amino acids.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquoted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Western blot analysis of ITGA2B using anti- ITGA2B antibody Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions. Lane 1: rat spleen tissue lysates, Lane 2: mouse spleen tissue lysates, After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti- ITGA2B antigen affinity purified polyclonal antibody at 0.5 ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for ITGA2B at approximately 125KD. The expected band size for ITGA2B is at 113KD.)

Western Blot (WB) (Western blot analysis of ITGA2B using anti- ITGA2B antibody Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions. Lane 1: rat spleen tissue lysates, Lane 2: mouse spleen tissue lysates, After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti- ITGA2B antigen affinity purified polyclonal antibody at 0.5 ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for ITGA2B at approximately 125KD. The expected band size for ITGA2B is at 113KD.)

Testing Data

(Anti- ITGA2B Picoband antibody, PB9647, IHC(P)IHC(P): Mouse Lung Tissue)

Testing Data (Anti- ITGA2B Picoband antibody, PB9647, IHC(P)IHC(P): Mouse Lung Tissue)

Immunohistochemistry (IHC)

(Anti- ITGA2B Picoband antibody, PB9647, IHC(P)IHC(P): Rat Lung Tissue)

Immunohistochemistry (IHC) (Anti- ITGA2B Picoband antibody, PB9647, IHC(P)IHC(P): Rat Lung Tissue)

Immunohistochemistry (IHC)

(Anti- ITGA2B Picoband antibody, PB9647, IHC(P)IHC(P): Human Mammary Cancer Tissue)

Immunohistochemistry (IHC) (Anti- ITGA2B Picoband antibody, PB9647, IHC(P)IHC(P): Human Mammary Cancer Tissue)

Western Blot (WB)

(Western blot analysis of ITGA2B using anti- ITGA2B antibody (PB9647). Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions. Lane 1: human HEK293 whole cell lysates, Lane 2: human HepG2 whole cell lysates, After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti- ITGA2B antigen affinity purified polyclonal antibody at 0.5 ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for ITGA2B at approximately 125KD. The expected band size for ITGA2B is at 113KD.)

Western Blot (WB) (Western blot analysis of ITGA2B using anti- ITGA2B antibody (PB9647). Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions. Lane 1: human HEK293 whole cell lysates, Lane 2: human HepG2 whole cell lysates, After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti- ITGA2B antigen affinity purified polyclonal antibody at 0.5 ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for ITGA2B at approximately 125KD. The expected band size for ITGA2B is at 113KD.)
Related Product Information for anti-ITGA2B antibody
Description: Rabbit IgG polyclonal antibody for Integrin alpha-Iib(ITGA2B) detection. Tested with WB, IHC-P in Human;Mouse;Rat.

Background: Integrin alpha-IIb is a protein that in humans is encoded by the ITGA2B gene. It is mapped to 17q21.32. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. Alpha chain 2b undergoes post-translational cleavage to yield disulfide-linked light and heavy chains that join with beta 3 to form a fibrinogen receptor expressed in platelets that plays a crucial role in coagulation. Mutations that interfere with this role result in thrombasthenia. In addition to adhesion, integrins are known to participate in cell-surface mediated signalling.
References
1. "Entrez Gene: ITGA2B integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41)". 2. Naik UP, Parise LV (1997). "Structure and function of platelet alpha IIb beta 3.". Curr. Opin. Hematol. 4(5): 317-22. 3. Quinn MJ, Byzova TV, Qin J et al. (2004). "Integrin alphaIIbbeta3 and its antagonism.". Arterioscler. Thromb. Vasc. Biol. 23 (6): 945-52.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
integrin alpha-IIb preproprotein
NCBI Official Synonym Full Names
integrin subunit alpha 2b
NCBI Official Symbol
ITGA2B
NCBI Official Synonym Symbols
GT; GTA; CD41; GP2B; HPA3; CD41B; GPIIb; BDPLT2; BDPLT16; PPP1R93
NCBI Protein Information
integrin alpha-IIb
UniProt Protein Name
Integrin alpha-IIb
Protein Family
UniProt Gene Name
ITGA2B
UniProt Synonym Gene Names
GP2B; ITGAB; GPIIb
UniProt Entry Name
ITA2B_HUMAN

NCBI Description

This gene encodes a member of the integrin alpha chain family of proteins. The encoded preproprotein is proteolytically processed to generate light and heavy chains that associate through disulfide linkages to form a subunit of the alpha-IIb/beta-3 integrin cell adhesion receptor. This receptor plays a crucial role in the blood coagulation system, by mediating platelet aggregation. Mutations in this gene are associated with platelet-type bleeding disorders, which are characterized by a failure of platelet aggregation, including Glanzmann thrombasthenia. [provided by RefSeq, Jan 2016]

Uniprot Description

ITGA2B: Integrin alpha-IIb/beta-3 is a receptor for fibronectin, fibrinogen, plasminogen, prothrombin, thrombospondin and vitronectin. It recognizes the sequence R-G-D in a wide array of ligands. It recognizes the sequence H-H-L-G-G-G-A-K-Q-A-G-D-V in fibrinogen gamma chain. Following activation integrin alpha- IIb/beta-3 brings about platelet/platelet interaction through binding of soluble fibrinogen. This step leads to rapid platelet aggregation which physically plugs ruptured endothelial cell surface. Belongs to the integrin alpha chain family. Heterodimer of an alpha and a beta subunit. The alpha subunit is composed of an heavy and a light chain linked by a disulfide bond. Alpha-IIb associates with beta-3. Directly interacts with RNF181. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Cell adhesion; Motility/polarity/chemotaxis; Membrane protein, integral

Chromosomal Location of Human Ortholog: 17q21.32

Cellular Component: cell surface; external side of plasma membrane; focal adhesion; integral to plasma membrane; integrin complex; plasma membrane; platelet alpha granule membrane

Molecular Function: extracellular matrix binding; identical protein binding; metal ion binding; protein binding

Biological Process: cell adhesion; cell-matrix adhesion; extracellular matrix organization and biogenesis; integrin-mediated signaling pathway; platelet degranulation; positive regulation of leukocyte migration

Disease: Bleeding Disorder, Platelet-type, 16; Glanzmann Thrombasthenia

Research Articles on ITGA2B

Similar Products

Product Notes

The ITGA2B itga2b (Catalog #AAA178307) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-ITGA2B Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. Western Blot Concencentration 0.1-0.5 ug/mL Tested Species: Mouse, Rat Predicted Species: Human Immunohistochemistry (Paraffin –embedded section) Concentration: 0.5-1 ug/mL Tested Species: Human, Mouse, Rat Antigen Retrieval : By Heat Tested Species: In house tested species with positive results Predicted Species: Species predicted to be fit for the product based on sequence similarities. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH 6.0 for 20 mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Researchers should empirically determine the suitability of the ITGA2B itga2b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ITGA2B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.