Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (35.64kD).)

Mouse anti-Human HOXC6 Monoclonal Antibody | anti-HOXC6 antibody

HOXC6 (HOX3C, Homeobox Protein Hox-C6, Homeobox Protein CP25, Homeobox Protein HHO.C8, Homeobox Protein Hox-3C) (Biotin)

Gene Names
HOXC6; CP25; HOX3; HOX3C; HHO.C8
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
HOXC6; Monoclonal Antibody; HOXC6 (HOX3C; Homeobox Protein Hox-C6; Homeobox Protein CP25; Homeobox Protein HHO.C8; Homeobox Protein Hox-3C) (Biotin); anti-HOXC6 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
2A4
Specificity
Recognizes human HOXC6.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-HOXC6 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa53-142 from human HOXC6 (NP_004494) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PFYSPQENVVFSSSRGPYDYGSNSFYQEKDMLSNCRQNTLGHNTQTSIAQDFSSEQGRTAPQDQKASIQIYPWMQRMNSHSGVGYGADRR
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (35.64kD).)

Western Blot (WB) (Western Blot detection against Immunogen (35.64kD).)
Related Product Information for anti-HOXC6 antibody
This protein belongs to the homeobox family, members of which encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, which are located on different chromosomes and consist of 9 to 11 genes arranged in tandem. This gene, HOXC6, is one of several HOXC genes located in a cluster on chromosome 12. Three genes, HOXC5, HOXC4 and HOXC6, share a 5' non-coding exon.
Product Categories/Family for anti-HOXC6 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
26,915 Da
NCBI Official Full Name
homeobox protein Hox-C6 isoform 1
NCBI Official Synonym Full Names
homeobox C6
NCBI Official Symbol
HOXC6
NCBI Official Synonym Symbols
CP25; HOX3; HOX3C; HHO.C8
NCBI Protein Information
homeobox protein Hox-C6; homeo box 3C; homeo box C6; homeo box C8 protein; homeobox protein CP25; homeobox protein HHO.C8; homeobox protein Hox-3C
UniProt Protein Name
Homeobox protein Hox-C6
Protein Family
UniProt Gene Name
HOXC6
UniProt Synonym Gene Names
HOX3C
UniProt Entry Name
HXC6_HUMAN

NCBI Description

This gene belongs to the homeobox family, members of which encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, which are located on different chromosomes and consist of 9 to 11 genes arranged in tandem. This gene, HOXC6, is one of several HOXC genes located in a cluster on chromosome 12. Three genes, HOXC5, HOXC4 and HOXC6, share a 5' non-coding exon. Transcripts may include the shared exon spliced to the gene-specific exons, or they may include only the gene-specific exons. Alternatively spliced transcript variants encoding different isoforms have been identified for HOXC6. Transcript variant two includes the shared exon, and transcript variant one includes only gene-specific exons. [provided by RefSeq, Jul 2008]

Uniprot Description

HOXC6: Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. Belongs to the Antp homeobox family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: DNA-binding; Transcription factor

Chromosomal Location of Human Ortholog: 12q13.3

Cellular Component: nucleoplasm; cytoplasm

Molecular Function: sequence-specific DNA binding; transcription corepressor activity; transcription factor activity

Biological Process: anterior/posterior pattern formation; regulation of transcription from RNA polymerase II promoter; transcription, DNA-dependent; embryonic skeletal development; multicellular organismal development

Research Articles on HOXC6

Similar Products

Product Notes

The HOXC6 hoxc6 (Catalog #AAA6142338) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The HOXC6 (HOX3C, Homeobox Protein Hox-C6, Homeobox Protein CP25, Homeobox Protein HHO.C8, Homeobox Protein Hox-3C) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's HOXC6 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the HOXC6 hoxc6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HOXC6, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.