Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.52kD).)

Mouse anti-Human HOXB5 Monoclonal Antibody | anti-HOXB5 antibody

HOXB5 (Homeobox Protein Hox-B5, Homeobox Protein HHO.C10, HOX2A, Homeobox Protein Hox-2A, Homeobox Protein Hu-1)

Gene Names
HOXB5; HOX2; HU-1; HOX2A; Hox2.1; HHO.C10
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
HOXB5; Monoclonal Antibody; HOXB5 (Homeobox Protein Hox-B5; Homeobox Protein HHO.C10; HOX2A; Homeobox Protein Hox-2A; Homeobox Protein Hu-1); Anti -HOXB5 (Homeobox Protein Hox-B5; anti-HOXB5 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3F10
Specificity
Recognizes human HOXB5.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
EGQTPQIFPWMRKLHISHDMTGPDGKRARTAYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLSERQIKIWFQNRRMKWKKDNKLKSMSLATAGSAF
Applicable Applications for anti-HOXB5 antibody
ELISA (EL/EIA), Western Blot (WB)
Application Notes
Suitable for use in ELISA and Western Blot.
Immunogen
Partial recombinant corresponding to aa170-367 from human HOXB5 (NP_002138.1) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.52kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.52kD).)

Western Blot (WB)

(Western Blot analysis of HOXB5 expression in transfected 293T cell line by HOXB5 monoclonal antibody.|Lane 1: HOXB5 transfected lysate (29.4kD).|Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of HOXB5 expression in transfected 293T cell line by HOXB5 monoclonal antibody.|Lane 1: HOXB5 transfected lysate (29.4kD).|Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged HOXB5 is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged HOXB5 is ~0.1ng/ml as a capture antibody.)
Related Product Information for anti-HOXB5 antibody
Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.
Product Categories/Family for anti-HOXB5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
29,434 Da
NCBI Official Full Name
homeobox protein Hox-B5
NCBI Official Synonym Full Names
homeobox B5
NCBI Official Symbol
HOXB5
NCBI Official Synonym Symbols
HOX2; HU-1; HOX2A; Hox2.1; HHO.C10
NCBI Protein Information
homeobox protein Hox-B5; homeo box 2A; homeo box B5; homeobox protein Hu-1; homeobox protein Hox-2A; homeobox protein HHO.C10
UniProt Protein Name
Homeobox protein Hox-B5
Protein Family
UniProt Gene Name
HOXB5
UniProt Synonym Gene Names
HOX2A
UniProt Entry Name
HXB5_HUMAN

NCBI Description

This gene is a member of the Antp homeobox family and encodes a nuclear protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17. The encoded protein functions as a sequence-specific transcription factor that is involved in lung and gut development. Increased expression of this gene is associated with a distinct biologic subset of acute myeloid leukemia (AML) and the occurrence of bronchopulmonary sequestration (BPS) and congenital cystic adenomatoid malformation (CCAM) tissue. [provided by RefSeq, Jul 2008]

Uniprot Description

Function: Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.

Subcellular location: Nucleus.

Tissue specificity: Spinal cord.

Developmental stage: Embryo.

Sequence similarities: Belongs to the Antp homeobox family.Contains 1 homeobox DNA-binding domain.

Sequence caution: The sequence AAA52681.1 differs from that shown. Reason: Erroneous initiation.

Research Articles on HOXB5

Similar Products

Product Notes

The HOXB5 hoxb5 (Catalog #AAA647580) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The HOXB5 (Homeobox Protein Hox-B5, Homeobox Protein HHO.C10, HOX2A, Homeobox Protein Hox-2A, Homeobox Protein Hu-1) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's HOXB5 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Suitable for use in ELISA and Western Blot. Researchers should empirically determine the suitability of the HOXB5 hoxb5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: EGQTPQIFPW MRKLHISHDM TGPDGKRART AYTRYQTLEL EKEFHFNRYL TRRRRIEIAH ALCLSERQIK IWFQNRRMKW KKDNKLKSMS LATAGSAF. It is sometimes possible for the material contained within the vial of "HOXB5, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.