Mouse anti-Human HOXB5 Monoclonal Antibody | anti-HOXB5 antibody

HOXB5 (Homeobox Protein Hox-B5, Homeobox Protein HHO.C10, HOX2A, Homeobox Protein Hox-2A, Homeobox Protein Hu-1) (HRP)

Cat. Num. AAA6152937

• Gene Names: HOXB5; HOX2; HU-1; HOX2A; Hox2.1; HHO.C10
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: HOXB5; Monoclonal Antibody; HOXB5 (Homeobox Protein Hox-B5; Homeobox Protein HHO.C10; HOX2A; Homeobox Protein Hox-2A; Homeobox Protein Hu-1) (HRP); anti-HOXB5 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 3F10
• Specificity: Recognizes human HOXB5.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-HOXB5 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa170-367 from human HOXB5 (NP_002138.1) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: EGQTPQIFPWMRKLHISHDMTGPDGKRARTAYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLSERQIKIWFQNRRMKWKKDNKLKSMSLATAGSAF
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.52kD).)

Western Blot (WB)

(Western Blot analysis of HOXB5 expression in transfected 293T cell line by HOXB5 monoclonal antibody. Lane 1: HOXB5 transfected lysate (29.4kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged HOXB5 is ~0.1ng/ml as a capture antibody.)

Related Product Information for anti-HOXB5 antibody

Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.

Product Categories/Family for anti-HOXB5 antibody

Antibodies; Transcription Factors; Homeobox (HOX)

NCBI and Uniprot Product Information

• NCBI GI #: 85380096
• NCBI GeneID: 3215
• NCBI Accession #: NP_002138.1
• NCBI GenBank Nucleotide #: NM_002147
• Molecular Weight: 29,434 Da
• NCBI Official Full Name: Homo sapiens homeobox B5 (HOXB5), mRNA
• NCBI Official Synonym Full Names: homeobox B5
• NCBI Official Symbol: HOXB5
• NCBI Official Synonym Symbols: HOX2; HU-1; HOX2A; Hox2.1; HHO.C10
• NCBI Protein Information: homeobox protein Hox-B5; homeo box 2A; homeo box B5; homeobox protein HHO.C10; homeobox protein Hox-2A; homeobox protein Hu-1
• Protein Family: Homeobox protein

NCBI Description

This gene is a member of the Antp homeobox family and encodes a nuclear protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17. The encoded protein functions as a sequence-specific transcription factor that is involved in lung and gut development. Increased expression of this gene is associated with a distinct biologic subset of acute myeloid leukemia (AML) and the occurrence of bronchopulmonary sequestration (BPS) and congenital cystic adenomatoid malformation (CCAM) tissue. [provided by RefSeq, Jul 2008]