Mouse anti-Human HNF4A Monoclonal Antibody | anti-HNF4A antibody

HNF4A (Hepatocyte Nuclear Factor 4-alpha, HNF-4-alpha, Transcription Factor HNF-4, Nuclear Receptor Subfamily 2 Group A Member 1, Transcription Factor 14, HNF4, NR2A1, TCF14) (PE)

Cat. Num. AAA6158220

• Gene Names: HNF4A; TCF; HNF4; MODY; FRTS4; MODY1; NR2A1; TCF14; HNF4a7; HNF4a8; HNF4a9; NR2A21; HNF4alpha
• Reactivity: Human
• Applications: ELISA, Immunofluorescence, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: HNF4A; Monoclonal Antibody; HNF4A (Hepatocyte Nuclear Factor 4-alpha; HNF-4-alpha; Transcription Factor HNF-4; Nuclear Receptor Subfamily 2 Group A Member 1; Transcription Factor 14; HNF4; NR2A1; TCF14) (PE); anti-HNF4A antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 4E2
• Specificity: Recognizes human HNF4A.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-HNF4A antibody: ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
• Application Notes: IF: 10ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa324-423 from human HNF4A (NP_000448) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: NDRQYDSRGRFGELLLLLPTLQSITWQMIEQIQFIKLFGMAKIDNLLQEMLLGGSPSDAPHAHHPLHPHLMQEHMGTNVIVANTMPTHLSNGQMCEWPRP
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB)

(HNF4A monoclonal antibody Western Blot analysis of HNF4A expression in HepG2)

Western Blot (WB)

(HNF4A monoclonal antibody Western Blot analysis of HNF4A expression in Jurkat.)

Western Blot (WB)

(Western Blot analysis of HNF4A expression in transfected 293T cell line by HNF4A monoclonal antibody. Lane 1: HNF4A transfected lysate (51.6kD). Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to HNF4A on HeLa cell. [antibody concentration 10ug/ml])

Testing Data

(Detection limit for recombinant GST tagged HNF4A is ~1ng/ml as a capture antibody.)

Western Blot (WB)

(Western blot analysis of HNF4A over-expressed 293 cell line, cotransfected with HNF4A Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with HNF4A monoclonal antibody GAPDH (36.1kD) used as specificity and loading control.)

Product Categories/Family for anti-HNF4A antibody

Antibodies; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 31077205
• NCBI GeneID: 3172
• NCBI Accession #: NP_000448
• NCBI GenBank Nucleotide #: NM_000457
• UniProt Accession #: A5JW41; O00659; O00723; Q14540; Q5QPB8; Q6B4V5; Q6B4V6; Q6B4V7; Q92653; Q92654; B2RPP8; P41235
• Molecular Weight: 43,988 Da
• NCBI Official Full Name: hepatocyte nuclear factor 4-alpha isoform HNF4alpha2
• NCBI Official Synonym Full Names: hepatocyte nuclear factor 4, alpha
• NCBI Official Symbol: HNF4A
• NCBI Official Synonym Symbols: TCF; HNF4; MODY; FRTS4; MODY1; NR2A1; TCF14; HNF4a7; HNF4a8; HNF4a9; NR2A21; HNF4alpha
• NCBI Protein Information: hepatocyte nuclear factor 4-alpha; HNF4alpha10/11/12; TCF-14; hepatic nuclear factor 4 alpha; nuclear receptor subfamily 2 group A member 1; transcription factor 14; transcription factor HNF-4
• UniProt Protein Name: Hepatocyte nuclear factor 4-alpha
• Protein Family: Hepatocyte nuclear factor
• UniProt Gene Name: HNF4A
• UniProt Synonym Gene Names: HNF4; NR2A1; TCF14; HNF-4-alpha; TCF-14
• UniProt Entry Name: HNF4A_HUMAN