Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37kD).)

Mouse anti-Human HMX2 Monoclonal Antibody | anti-HMX2 antibody

HMX2 (Homeobox Protein HMX2, Homeobox Protein H6 Family Member 2) (FITC)

Gene Names
HMX2; H6L; Nkx5-2
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
HMX2; Monoclonal Antibody; HMX2 (Homeobox Protein HMX2; Homeobox Protein H6 Family Member 2) (FITC); anti-HMX2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1B10
Specificity
Recognizes human HMX2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-HMX2 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa125-224 from human HMX2 (NP_005510) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PAGSPSPGSERPRDGGAERQAGAAKKKTRTVFSRSQVYQLESTFDMKRYLSSSERACLASSLQLTETQVKTWFQNRRNKWKRQLSAELEAANMAHASAQT
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37kD).)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to HMX2 on formalin-fixed paraffin-embedded human pancreas. [antibody concentration 3ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to HMX2 on formalin-fixed paraffin-embedded human pancreas. [antibody concentration 3ug/ml])
Product Categories/Family for anti-HMX2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
29kDa
NCBI Official Full Name
homeobox protein HMX2
NCBI Official Synonym Full Names
H6 family homeobox 2
NCBI Official Symbol
HMX2
NCBI Official Synonym Symbols
H6L; Nkx5-2
NCBI Protein Information
homeobox protein HMX2
UniProt Protein Name
Homeobox protein HMX2
Protein Family
UniProt Gene Name
HMX2
UniProt Entry Name
HMX2_HUMAN

NCBI Description

The protein encoded by this gene is a member of the NKL homeobox family of transcription factors. Members in this family are of ancient origin and play an important role in organ development during embryogenesis. A related mouse protein plays a role in patterning of inner ear structures. In humans, variations in a region containing this gene have been associated with inner ear malformations, vestibular dysfunction, and hearing loss. [provided by RefSeq, Aug 2012]

Uniprot Description

HMX2: Transcription factor involved in specification of neuronal cell types and which is required for inner ear and hypothalamus development. Belongs to the HMX homeobox family.

Protein type: DNA-binding

Chromosomal Location of Human Ortholog: 10q26.13

Cellular Component: nucleus

Molecular Function: sequence-specific DNA binding

Biological Process: positive regulation of nuclear mRNA splicing, via spliceosome; inner ear morphogenesis; transcription, DNA-dependent; regulation of transcription, DNA-dependent; positive regulation of cell proliferation; brain development; cell differentiation

Research Articles on HMX2

Similar Products

Product Notes

The HMX2 hmx2 (Catalog #AAA6147612) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The HMX2 (Homeobox Protein HMX2, Homeobox Protein H6 Family Member 2) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's HMX2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the HMX2 hmx2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HMX2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.