Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.51kD).)

Mouse anti-Human HMGA1 Monoclonal Antibody | anti-HMGA1 antibody

HMGA1 (High Mobility Group Protein HMG-I/HMG-Y, HMG-I(Y), High Mobility Group AT-hook Protein 1, High Mobility Group Protein A1, High Mobility Group Protein R, HMGIY, MGC12816, MGC4242, MGC4854) (PE)

Gene Names
HMGA1; HMG-R; HMGIY; HMGA1A
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
HMGA1; Monoclonal Antibody; HMGA1 (High Mobility Group Protein HMG-I/HMG-Y; HMG-I(Y); High Mobility Group AT-hook Protein 1; High Mobility Group Protein A1; High Mobility Group Protein R; HMGIY; MGC12816; MGC4242; MGC4854) (PE); anti-HMGA1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
2A1
Specificity
Recognizes human HMGA1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-HMGA1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-107 from human HMGA1 (NP_665906.1) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MSESSSKSSQPLASKQEKDGTEKRGRGRPRKQPPVSPGTALVGSQKEPSEVPTPKRPRGRPKGSKNKGAAKTRKTTTTPGRKPRGRPKKLEKEEEEGISQESSEEEQ
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.51kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.51kD).)
Product Categories/Family for anti-HMGA1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
11,676 Da
NCBI Official Full Name
high mobility group protein HMG-I/HMG-Y isoform a
NCBI Official Synonym Full Names
high mobility group AT-hook 1
NCBI Official Symbol
HMGA1
NCBI Official Synonym Symbols
HMG-R; HMGIY; HMGA1A
NCBI Protein Information
high mobility group protein HMG-I/HMG-Y; HMG-I(Y); high mobility group protein R; high mobility group protein A1; nonhistone chromosomal high-mobility group protein HMG-I/HMG-Y; high-mobility group (nonhistone chromosomal) protein isoforms I and Y
UniProt Protein Name
High mobility group protein HMG-I/HMG-Y
UniProt Gene Name
HMGA1
UniProt Synonym Gene Names
HMGIY; HMG-I(Y)
UniProt Entry Name
HMGA1_HUMAN

NCBI Description

This gene encodes a non-histone protein involved in many cellular processes, including regulation of inducible gene transcription, integration of retroviruses into chromosomes, and the metastatic progression of cancer cells. The encoded protein preferentially binds to the minor groove of A+T-rich regions in double-stranded DNA. It has little secondary structure in solution but assumes distinct conformations when bound to substrates such as DNA or other proteins. The encoded protein is frequently acetylated and is found in the nucleus. At least seven transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

HMGA1: HMG-I/Y bind preferentially to the minor groove of A+T rich regions in double stranded DNA. It is suggested that these proteins could function in nucleosome phasing and in the 3'-end processing of mRNA transcripts. They are also involved in the transcription regulation of genes containing, or in close proximity to A+T-rich regions. A chromosomal aberration involving HMGA1 is found in pulmonary chondroid hamartoma. Translocation t(6;14)(p21;q23-24) with RAD51B. Belongs to the HMGA family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: DNA-binding

Chromosomal Location of Human Ortholog: 6p21

Cellular Component: nucleoplasm; transcription factor complex; focal adhesion; cytosol; nucleus

Molecular Function: retinoid X receptor binding; protein binding; peroxisome proliferator activated receptor binding; enzyme binding; DNA-(apurinic or apyrimidinic site) lyase activity; ligand-dependent nuclear receptor transcription coactivator activity; DNA binding; AT DNA binding; retinoic acid receptor binding; 5'-deoxyribose-5-phosphate lyase activity; transcription factor binding

Biological Process: DNA unwinding during replication; viral reproduction; transcription, DNA-dependent; positive regulation of transcription, DNA-dependent; response to virus; DNA catabolic process, endonucleolytic; negative regulation of cell proliferation; nucleosome disassembly; regulation of transcription, DNA-dependent; negative regulation of chromatin silencing; base-excision repair; protein complex assembly; negative regulation of transcription, DNA-dependent

Research Articles on HMGA1

Similar Products

Product Notes

The HMGA1 hmga1 (Catalog #AAA6158211) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The HMGA1 (High Mobility Group Protein HMG-I/HMG-Y, HMG-I(Y), High Mobility Group AT-hook Protein 1, High Mobility Group Protein A1, High Mobility Group Protein R, HMGIY, MGC12816, MGC4242, MGC4854) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's HMGA1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the HMGA1 hmga1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HMGA1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.