<
Flow Cytometry (FC/FACS)
Mouse anti-Human HMG4 Monoclonal Antibody | anti-HMGB3 antibody
Anti-HMG4 Antibody (Monoclonal, 7G13)
Gene Names
HMGB3; HMG4; HMG-4; HMG2A; HMG-2a
Reactivity
Human
Applications
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Flow Cytometry, Functional Assay
Purity
Immunogen affinity purified.
Synonyms
HMG4; Monoclonal Antibody; Anti-HMG4 Antibody (Monoclonal; 7G13); chromosomal protein; Nonhistone; HMG4 antibody; High mobility group (nonhistone chromosomal) protein 4 antibody; High mobility group box 3 antibody; High mobility group protein 2a antibody; High mobility group protein 4 antibody; High mobility group protein B3 antibody; High mobility group protein HMG4 antibody; HMG 4 antibody; HMG-2a antibody; HMG-4 antibody; HMG2A antibody; HMGB 3 antibody; HMGB3 antibody; HMGB3_HUMAN antibody; MGC90319 antibody; Non histone chromosomal protein antibody; Nonhistone chromosomal protein HMG4 antibody; anti-HMGB3 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b
Clone Number
7G13
Specificity
No cross reactivity with other proteins.
Purity/Purification
Immunogen affinity purified.
Form/Format
Lyophilized
Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
200
Applicable Applications for anti-HMGB3 antibody
Western Blot (WB), Immunohistochemistry (IHC) Paraffin, Immunocytochemistry (ICC), Immunofluorescence (IF), Flow Cytometry (FC/FACS)
Application Notes
WB: 0.1-0.5ug/ml (Human)
IHC-P (Embedded Section): 0.5-1ug/ml (Human)
ICC: 2ug/ml (Human)
IF: 2ug/ml (Human)
FC/FACS: 1-3ug/1x106 cells (Human)
Tested Species: In-house tested species with positive results.
IHC-P (Embedded Section): 0.5-1ug/ml (Human)
ICC: 2ug/ml (Human)
IF: 2ug/ml (Human)
FC/FACS: 1-3ug/1x106 cells (Human)
Tested Species: In-house tested species with positive results.
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human HMG4 (62-95aa EMAKADKVRYDREMKDYGPAKGGKKKKDPNAPKR), identical to the related mouse and rat sequences.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen store at -20 degree C for a longer time. Avoid repeated freezing and thawing.
Flow Cytometry (FC/FACS)
Flow Cytometry (FC/FACS)
Immunofluorescence (IF)
Immunofluorescence (IF)
Immunohistochemistry (IHC)
Immunohistochemistry (IHC)
Western Blot (WB)
Western Blot (WB)
Related Product Information for anti-HMGB3 antibody
Description: Mouse IgG monoclonal antibody for HMG4 detection. Tested with WB, IHC-P, ICC/IF, FCM in Human.
Background: High-mobility group protein B, also known as HMG4, is a protein that in humans is encoded by the HMGB3 gene. This gene encodes a member of a family of proteins containing one or more high mobility group DNA-binding motifs. The encoded protein plays an important role in maintaining stem cell populations, and may be aberrantly expressed in tumor cells. A mutation in this gene was associated with microphthalmia, syndromic 13. There are numerous pseudogenes of this gene on multiple chromosomes. Alternative splicing results in multiple transcript variants.
Background: High-mobility group protein B, also known as HMG4, is a protein that in humans is encoded by the HMGB3 gene. This gene encodes a member of a family of proteins containing one or more high mobility group DNA-binding motifs. The encoded protein plays an important role in maintaining stem cell populations, and may be aberrantly expressed in tumor cells. A mutation in this gene was associated with microphthalmia, syndromic 13. There are numerous pseudogenes of this gene on multiple chromosomes. Alternative splicing results in multiple transcript variants.
References
1. "Entrez Gene: HMGB3 high-mobility group box 3".
2. Davis DL, Burch JB (1992). "Isolation of a chicken HMG2 cDNA clone and evidence for an HMG2-specific 3'-untranslated region.". Gene 113 (2): 251-6.
3. Vaccari T, Beltrame M, Ferrari S, Bianchi ME (Aug 1998). "Hmg4, a new member of the Hmg1/2 gene family".Genomics 49 (2): 247-52.
2. Davis DL, Burch JB (1992). "Isolation of a chicken HMG2 cDNA clone and evidence for an HMG2-specific 3'-untranslated region.". Gene 113 (2): 251-6.
3. Vaccari T, Beltrame M, Ferrari S, Bianchi ME (Aug 1998). "Hmg4, a new member of the Hmg1/2 gene family".Genomics 49 (2): 247-52.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
UniProt Accession #
NCBI Official Full Name
High mobility group protein B3
NCBI Official Synonym Full Names
high mobility group box 3
NCBI Official Symbol
HMGB3
NCBI Official Synonym Symbols
HMG4; HMG-4; HMG2A; HMG-2a
NCBI Protein Information
high mobility group protein B3
UniProt Protein Name
High mobility group protein B3
Protein Family
UniProt Gene Name
HMGB3
UniProt Synonym Gene Names
HMG2A; HMG4; HMG-2a; HMG-4
UniProt Entry Name
HMGB3_HUMAN
NCBI Description
This gene encodes a member of a family of proteins containing one or more high mobility group DNA-binding motifs. The encoded protein plays an important role in maintaining stem cell populations, and may be aberrantly expressed in tumor cells. A mutation in this gene was associated with microphthalmia, syndromic 13. There are numerous pseudogenes of this gene on multiple chromosomes. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2014]
Uniprot Description
HMGB3: Binds preferentially single-stranded DNA and unwinds double stranded DNA. Belongs to the HMGB family.
Protein type: DNA-binding
Chromosomal Location of Human Ortholog: Xq28
Cellular Component: chromosome; nucleus
Molecular Function: double-stranded DNA binding; chromatin binding; DNA bending activity
Biological Process: chromatin remodeling; negative regulation of B cell differentiation; negative regulation of myeloid cell differentiation; regulation of transcription, DNA-dependent; multicellular organismal development; DNA recombination
Disease: Microphthalmia, Syndromic 13
Research Articles on HMGB3
Similar Products
Product Notes
The HMGB3 hmgb3 (Catalog #AAA1753238) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Anti-HMG4 Antibody (Monoclonal, 7G13) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's HMG4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC) Paraffin, Immunocytochemistry (ICC), Immunofluorescence (IF), Flow Cytometry (FC/FACS). WB: 0.1-0.5ug/ml (Human) IHC-P (Embedded Section): 0.5-1ug/ml (Human) ICC: 2ug/ml (Human) IF: 2ug/ml (Human) FC/FACS: 1-3ug/1x106 cells (Human) Tested Species: In-house tested species with positive results. Researchers should empirically determine the suitability of the HMGB3 hmgb3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HMG4, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
