Western Blot (WB)
(Western Blot detection against Immunogen (35.31kD).)
Mouse anti-Human HLA-DQA1 Monoclonal Antibody | anti-HLA-DQA1 antibody
HLA-DQA1 (HLA Class II Histocompatibility Antigen, DQ alpha 1 Chain, DC-1 alpha Chain, DC-alpha, HLA-DCA, MHC Class II DQA1) (AP)
Gene Names
HLA-DQA1; CD; GSE; DQ-A1; CELIAC1; HLA-DQA
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
HLA-DQA1; Monoclonal Antibody; HLA-DQA1 (HLA Class II Histocompatibility Antigen; DQ alpha 1 Chain; DC-1 alpha Chain; DC-alpha; HLA-DCA; MHC Class II DQA1) (AP); anti-HLA-DQA1 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1A3
Specificity
Recognizes human HLA-DQA1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-HLA-DQA1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa24-110 from human HLA-DQA1 (NP_002113.2) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
EDIVADHVASCGVNLYQFYGPSGQYTHEFDGDEEFYVDLERKETAWRWPEFSKFGGFDPQGALRNMAVAKHNLNIMIKRYNSTAATN
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Western Blot (WB)
(Western Blot detection against Immunogen (35.31kD).)
Western Blot (WB)
(Western Blot detection against Immunogen (35.31kD).)
Testing Data
(Detection limit for recombinant GST tagged HLA-DQA1 is 0.3ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged HLA-DQA1 is 0.3ng/ml as a capture antibody.)
Testing Data
(Proximity Ligation Analysis (PLA) of protein-protein interactions between CD74 and HLA-DQA1. HeLa cells were stained with CD74 rabbit purified polyclonal 1:1200 and HLA-DQA1 mouse monoclonal antibody 1:50. Signals were detected 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)
Testing Data
(Proximity Ligation Analysis (PLA) of protein-protein interactions between CD74 and HLA-DQA1. HeLa cells were stained with CD74 rabbit purified polyclonal 1:1200 and HLA-DQA1 mouse monoclonal antibody 1:50. Signals were detected 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)
Product Categories/Family for anti-HLA-DQA1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
254
NCBI Official Full Name
HLA class II histocompatibility antigen, DQ alpha 1 chain
NCBI Official Synonym Full Names
major histocompatibility complex, class II, DQ alpha 1
NCBI Official Symbol
HLA-DQA1
NCBI Official Synonym Symbols
CD; GSE; DQ-A1; CELIAC1; HLA-DQA
NCBI Protein Information
HLA class II histocompatibility antigen, DQ alpha 1 chain; HLA-DCA; DC-alpha; DC-1 alpha chain; MHC HLA-DQ alpha; MHC class II DQA1; MHC class II antigen; leucocyte antigen DQA1; MHC class II HLA-DQ-alpha-1; leukocyte antigen alpha chain; MHC class II sur
UniProt Protein Name
HLA class II histocompatibility antigen, DQ alpha 1 chain
Protein Family
UniProt Gene Name
HLA-DQA1
UniProt Entry Name
DQA1_HUMAN
Uniprot Description
HLA-DQA1 iso4:
Protein type: Membrane protein, integral; Cell surface
Chromosomal Location of Human Ortholog: 6p21.3
Cellular Component: Golgi membrane; membrane; lysosomal membrane; integral to plasma membrane; plasma membrane; trans-Golgi network membrane; endosome membrane; MHC class II protein complex; external side of plasma membrane
Molecular Function: MHC class II receptor activity; peptide antigen binding
Biological Process: positive regulation of T cell differentiation; cytokine and chemokine mediated signaling pathway; T cell costimulation; antigen processing and presentation of exogenous peptide antigen via MHC class II; immune response; T cell receptor signaling pathway
Similar Products
Product Notes
The HLA-DQA1 hla-dqa1 (Catalog #AAA6131689) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The HLA-DQA1 (HLA Class II Histocompatibility Antigen, DQ alpha 1 Chain, DC-1 alpha Chain, DC-alpha, HLA-DCA, MHC Class II DQA1) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's HLA-DQA1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the HLA-DQA1 hla-dqa1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HLA-DQA1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
