Mouse anti-Human HIST1H2AC Monoclonal Antibody | anti-HIST1H2AC antibody

HIST1H2AC (Histone H2A Type 1-C, Histone H2A/l, H2AFL, dJ221C16.4, MGC99519) (HRP)

Cat. Num. AAA6152890

• Gene Names: H2AC6; H2A/l; H2AFL; HIST1H2AC; dJ221C16.4
• Reactivity: Human
• Applications: ELISA
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: HIST1H2AC; Monoclonal Antibody; HIST1H2AC (Histone H2A Type 1-C; Histone H2A/l; H2AFL; dJ221C16.4; MGC99519) (HRP); anti-HIST1H2AC antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 4F10
• Specificity: Recognizes human HIST1H2AC.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
• Sequence Length: 130

• Applicable Applications for anti-HIST1H2AC antibody: ELISA (EIA)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa25-97 from HIST1H2AC (NP_003503) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: QFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNK
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged HIST1H2AC is 0.1ng/ml as a capture antibody.)

Product Categories/Family for anti-HIST1H2AC antibody

Antibodies; Histones

NCBI and Uniprot Product Information

• NCBI GI #: 4504245
• NCBI GeneID: 8334
• NCBI Accession #: NP_003503
• NCBI GenBank Nucleotide #: NM_003512
• UniProt Accession #: Q93077
• NCBI Official Full Name: histone H2A type 1-C
• NCBI Official Synonym Full Names: H2A clustered histone 6
• NCBI Official Symbol: H2AC6
• NCBI Official Synonym Symbols: H2A/l; H2AFL; HIST1H2AC; dJ221C16.4
• NCBI Protein Information: histone H2A type 1-C
• UniProt Protein Name: Histone H2A type 1-C
• UniProt Gene Name: HIST1H2AC
• UniProt Synonym Gene Names: H2AFL

NCBI Description

Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H2A family. Transcripts from this gene lack polyA tails but instead contain a palindromic termination element. This gene is found in the large histone gene cluster on chromosome 6. [provided by RefSeq, Aug 2015]

Uniprot Description

Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.