Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged HIST1H2AC is 0.1ng/ml as a capture antibody.)

Mouse anti-Human HIST1H2AC Monoclonal Antibody | anti-HIST1H2AC antibody

HIST1H2AC (Histone H2A Type 1-C, Histone H2A/l, H2AFL, dJ221C16.4, MGC99519) (FITC)

Gene Names
H2AC6; H2A/l; H2AFL; HIST1H2AC; dJ221C16.4
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
HIST1H2AC; Monoclonal Antibody; HIST1H2AC (Histone H2A Type 1-C; Histone H2A/l; H2AFL; dJ221C16.4; MGC99519) (FITC); anti-HIST1H2AC antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
4F10
Specificity
Recognizes human HIST1H2AC.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Sequence Length
130
Applicable Applications for anti-HIST1H2AC antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa25-97 from HIST1H2AC (NP_003503) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
QFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNK
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged HIST1H2AC is 0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged HIST1H2AC is 0.1ng/ml as a capture antibody.)
Product Categories/Family for anti-HIST1H2AC antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
histone H2A type 1-C
NCBI Official Synonym Full Names
H2A clustered histone 6
NCBI Official Symbol
H2AC6
NCBI Official Synonym Symbols
H2A/l; H2AFL; HIST1H2AC; dJ221C16.4
NCBI Protein Information
histone H2A type 1-C
UniProt Protein Name
Histone H2A type 1-C
UniProt Gene Name
HIST1H2AC
UniProt Synonym Gene Names
H2AFL

NCBI Description

Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H2A family. Transcripts from this gene lack polyA tails but instead contain a palindromic termination element. This gene is found in the large histone gene cluster on chromosome 6. [provided by RefSeq, Aug 2015]

Uniprot Description

Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.

Similar Products

Product Notes

The HIST1H2AC hist1h2ac (Catalog #AAA6147587) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The HIST1H2AC (Histone H2A Type 1-C, Histone H2A/l, H2AFL, dJ221C16.4, MGC99519) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's HIST1H2AC can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the HIST1H2AC hist1h2ac for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HIST1H2AC, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.