Mouse anti-Human HIPK1 Monoclonal Antibody | anti-HIPK1 antibody

HIPK1 (Homeodomain-interacting Protein Kinase 1, Nuclear Body-associated Kinase 2, KIAA0630, MYAK, NBAK2, MGC26642, MGC33446, MGC33548) (FITC)

Cat. Num. AAA6147583

• Gene Names: HIPK1; Myak; Nbak2
• Reactivity: Human
• Applications: ELISA, Immunofluorescence, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: HIPK1; Monoclonal Antibody; HIPK1 (Homeodomain-interacting Protein Kinase 1; Nuclear Body-associated Kinase 2; KIAA0630; MYAK; NBAK2; MGC26642; MGC33446; MGC33548) (FITC); anti-HIPK1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 1F2
• Specificity: Recognizes human HIPK1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
• Sequence Length: 3102

• Applicable Applications for anti-HIPK1 antibody: ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
• Application Notes: IF: 35ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant protein corresponding to aa330-430 from human HIPK1 (AAH28408) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: CTPLMVATLHPQVATITPQYAVPFTLSCAAGRPALVEQTAAVLQAWPGGTQQILLPSTWQQLPGVALHNSVQPTAMIPEAMGSGQQLADWRNAHSHGNQYS
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB)

(HIPK1 monoclonal antibody, Western Blot analysis of HIPK1 expression in HeLa.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to HIPK1 on HeLa cell. [antibody concentration 35ug/ml].)

Product Categories/Family for anti-HIPK1 antibody

Antibodies; Protein Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 20306936
• NCBI GeneID: 204851
• NCBI Official Full Name: Homo sapiens homeodomain interacting protein kinase 1, mRNA
• NCBI Official Synonym Full Names: homeodomain interacting protein kinase 1
• NCBI Official Symbol: HIPK1
• NCBI Official Synonym Symbols: Myak; Nbak2
• NCBI Protein Information: homeodomain-interacting protein kinase 1

NCBI Description

The protein encoded by this gene belongs to the Ser/Thr family of protein kinases and HIPK subfamily. It phosphorylates homeodomain transcription factors and may also function as a co-repressor for homeodomain transcription factors. Alternative splicing results in four transcript variants encoding four distinct isoforms. [provided by RefSeq, Jul 2008]