Mouse anti-Human HGS Monoclonal Antibody | anti-HGS antibody

HGS (HRS, Hepatocyte Growth Factor Regulated Tyrosine Kinase Substrate, HGNC:4897, Human Growth Factor Regulated Tyrosine Kinase Substrate, Protein pp110, ZFYVE8) (HRP)

Cat. Num. AAA6152876

• Gene Names: HGS; HRS
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: HGS; Monoclonal Antibody; HGS (HRS; Hepatocyte Growth Factor Regulated Tyrosine Kinase Substrate; HGNC:4897; Human Growth Factor Regulated Tyrosine Kinase Substrate; Protein pp110; ZFYVE8) (HRP); anti-HGS antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 6D11
• Specificity: Recognizes human HGS.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-HGS antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa513-612 from HGS (AAH03565) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: KLEIMRQKKQEYLEVQRQLAIQRLQEQEKERQMRLEQQKQTVQMRAQMPAFPLPYAQLQAMPAAGGVLYQPSGPASFPSTFSPAGSVEGSPMHGVYMSQP
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(HGS monoclonal antibody Western Blot analysis of HGS expression in K-562)

Western Blot (WB)

(Western Blot analysis of HGS expression in transfected 293T cell line by HGS monoclonal antibody Lane 1: HGS transfected lysate (86.2kD). Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to HGS on HeLa cell. [antibody concentration 10ug/ml])

Testing Data

(Detection limit for recombinant GST tagged HGS is ~0.03ng/ml as a capture antibody.)

Western Blot (WB)

(Western blot analysis of HGS over-expressed 293 cell line, cotransfected with HGS Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with HGS monoclonal antibody GAPDH (36.1kD) used as specificity and loading control.)

Related Product Information for anti-HGS antibody

HGS is involved in intracellular signal transduction mediated by cytokines and growth factors. When associated with STAM, it suppresses DNA signaling upon stimulation by IL-2 and GM-CSF. It could be a direct effector of PI3-kinase in vesicular pathway via early endosomes and may regulate trafficking to early and late endosomes by recruiting clathrin. HGS may concentrate ubiquitinated receptors within clathrin-coated regions. It is involved in down-regulation of receptor tyrosine kinase via multivesicular body (MVBs) when complexed with STAM. This complex binds ubiquitin and acts as sorting machinery that recognizes ubiquitinated receptors and transfers them to further sequential lysosomal sorting/trafficking processes. HGS may contribute to the efficient recruitment of SMADs to the activin receptor complex.

Product Categories/Family for anti-HGS antibody

Antibodies; Protein Kinase Substrates

References

1. The Class III Kinase Vps34 Promotes T Lymphocyte Survival through Regulating IL-7R? Surface Expression. McLeod IX, Zhou X, Li QJ, Wang F, He YW.J Immunol. 2011 Nov 15;187(10):5051-61. Epub 2011 Oct 21.

NCBI and Uniprot Product Information

• NCBI GI #: 13097722
• NCBI GeneID: 9146
• UniProt Accession #: O14964; Q9NR36
• Molecular Weight: 76,376 Da
• NCBI Official Full Name: Homo sapiens hepatocyte growth factor-regulated tyrosine kinase substrate, mRNA
• NCBI Official Synonym Full Names: hepatocyte growth factor-regulated tyrosine kinase substrate
• NCBI Official Symbol: HGS
• NCBI Official Synonym Symbols: HRS
• NCBI Protein Information: hepatocyte growth factor-regulated tyrosine kinase substrate
• UniProt Protein Name: Hepatocyte growth factor-regulated tyrosine kinase substrate
• Protein Family: Hepatocyte growth factor-regulated tyrosine kinase substrate
• UniProt Gene Name: HGS
• UniProt Synonym Gene Names: HRS
• UniProt Entry Name: HGS_HUMAN

NCBI Description

The protein encoded by this gene regulates endosomal sorting and plays a critical role in the recycling and degradation of membrane receptors. The encoded protein sorts monoubiquitinated membrane proteins into the multivesicular body, targeting these proteins for lysosome-dependent degradation. [provided by RefSeq, Dec 2010]

Uniprot Description

Hrs: a zinc finger protein which is rapidly tyrosine phosphorylated in cells stimulated with various growth factors. Hrs mRNA is expressed in all the human adult and fetal tissues tested.

Protein type: Motility/polarity/chemotaxis; Adaptor/scaffold

Chromosomal Location of Human Ortholog: 17q25

Cellular Component: intracellular membrane-bound organelle; early endosome membrane; early endosome; cytoplasm; cytosol; endosome; secretory granule

Molecular Function: protein domain specific binding; protein binding; metal ion binding

Biological Process: negative regulation of epidermal growth factor receptor signaling pathway; epidermal growth factor receptor signaling pathway; negative regulation of cell proliferation; protein targeting to lysosome; membrane invagination; endosome to lysosome transport; regulation of protein catabolic process; endosome transport; signal transduction; negative regulation of JAK-STAT cascade