Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (HGS monoclonal antibody Western Blot analysis of HGS expression in K-562)

Mouse anti-Human HGS Monoclonal Antibody | anti-HGS antibody

HGS (HRS, Hepatocyte Growth Factor Regulated Tyrosine Kinase Substrate, HGNC:4897, Human Growth Factor Regulated Tyrosine Kinase Substrate, Protein pp110, ZFYVE8) (Biotin)

Gene Names
HGS; HRS
Reactivity
Human
Applications
ELISA, Immunofluorescence, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
HGS; Monoclonal Antibody; HGS (HRS; Hepatocyte Growth Factor Regulated Tyrosine Kinase Substrate; HGNC:4897; Human Growth Factor Regulated Tyrosine Kinase Substrate; Protein pp110; ZFYVE8) (Biotin); anti-HGS antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
6D11
Specificity
Recognizes human HGS.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-HGS antibody
ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa513-612 from HGS (AAH03565) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
KLEIMRQKKQEYLEVQRQLAIQRLQEQEKERQMRLEQQKQTVQMRAQMPAFPLPYAQLQAMPAAGGVLYQPSGPASFPSTFSPAGSVEGSPMHGVYMSQP
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(HGS monoclonal antibody Western Blot analysis of HGS expression in K-562)

Western Blot (WB) (HGS monoclonal antibody Western Blot analysis of HGS expression in K-562)

Western Blot (WB)

(Western Blot analysis of HGS expression in transfected 293T cell line by HGS monoclonal antibody Lane 1: HGS transfected lysate (86.2kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of HGS expression in transfected 293T cell line by HGS monoclonal antibody Lane 1: HGS transfected lysate (86.2kD). Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to HGS on HeLa cell. [antibody concentration 10ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to HGS on HeLa cell. [antibody concentration 10ug/ml])

Testing Data

(Detection limit for recombinant GST tagged HGS is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged HGS is ~0.03ng/ml as a capture antibody.)

Western Blot (WB)

(Western blot analysis of HGS over-expressed 293 cell line, cotransfected with HGS Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with HGS monoclonal antibody GAPDH (36.1kD) used as specificity and loading control.)

Western Blot (WB) (Western blot analysis of HGS over-expressed 293 cell line, cotransfected with HGS Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with HGS monoclonal antibody GAPDH (36.1kD) used as specificity and loading control.)
Product Categories/Family for anti-HGS antibody
References
1. The Class III Kinase Vps34 Promotes T Lymphocyte Survival through Regulating IL-7R? Surface Expression. McLeod IX, Zhou X, Li QJ, Wang F, He YW.J Immunol. 2011 Nov 15;187(10):5051-61. Epub 2011 Oct 21.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
76,376 Da
NCBI Official Full Name
Homo sapiens hepatocyte growth factor-regulated tyrosine kinase substrate, mRNA
NCBI Official Synonym Full Names
hepatocyte growth factor-regulated tyrosine kinase substrate
NCBI Official Symbol
HGS
NCBI Official Synonym Symbols
HRS
NCBI Protein Information
hepatocyte growth factor-regulated tyrosine kinase substrate
UniProt Protein Name
Hepatocyte growth factor-regulated tyrosine kinase substrate
UniProt Gene Name
HGS
UniProt Synonym Gene Names
HRS
UniProt Entry Name
HGS_HUMAN

NCBI Description

The protein encoded by this gene regulates endosomal sorting and plays a critical role in the recycling and degradation of membrane receptors. The encoded protein sorts monoubiquitinated membrane proteins into the multivesicular body, targeting these proteins for lysosome-dependent degradation. [provided by RefSeq, Dec 2010]

Uniprot Description

Hrs: a zinc finger protein which is rapidly tyrosine phosphorylated in cells stimulated with various growth factors. Hrs mRNA is expressed in all the human adult and fetal tissues tested.

Protein type: Motility/polarity/chemotaxis; Adaptor/scaffold

Chromosomal Location of Human Ortholog: 17q25

Cellular Component: intracellular membrane-bound organelle; early endosome membrane; early endosome; cytoplasm; cytosol; endosome; secretory granule

Molecular Function: protein domain specific binding; protein binding; metal ion binding

Biological Process: negative regulation of epidermal growth factor receptor signaling pathway; epidermal growth factor receptor signaling pathway; negative regulation of cell proliferation; protein targeting to lysosome; membrane invagination; endosome to lysosome transport; regulation of protein catabolic process; endosome transport; signal transduction; negative regulation of JAK-STAT cascade

Research Articles on HGS

Similar Products

Product Notes

The HGS hgs (Catalog #AAA6142270) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The HGS (HRS, Hepatocyte Growth Factor Regulated Tyrosine Kinase Substrate, HGNC:4897, Human Growth Factor Regulated Tyrosine Kinase Substrate, Protein pp110, ZFYVE8) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's HGS can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the HGS hgs for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HGS, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.