Western Blot (WB)
(Western Blot detection against Immunogen (34.14kD), using MBS6000424.)
Mouse anti-Human HES2 Monoclonal Antibody | anti-HES2 antibody
HES2 (Transcription Factor HES-2, Class B Basic Helix-loop-helix Protein 40, bHLHb40, Hairy and Enhancer of Split 2, BHLHB40)
Gene Names
HES2; bHLHb40
Reactivity
Human
Applications
ELISA, Western Blot, Immunofluorescence
Purity
Affinity PurifiedPurified by Protein A affinity chromatography.
Synonyms
HES2; Monoclonal Antibody; HES2 (Transcription Factor HES-2; Class B Basic Helix-loop-helix Protein 40; bHLHb40; Hairy and Enhancer of Split 2; BHLHB40); Anti -HES2 (Transcription Factor HES-2; anti-HES2 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4H6
Specificity
Recognizes human HES2.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
LPLLGRENSNCSKLEKADVLEMTVRFLQELPASSWPTAAPLPCDSYREGYSACVARLARVLPACRVLEPAVSAR
Applicable Applications for anti-HES2 antibody
ELISA (EL/EIA), Western Blot (WB), Immunofluorescence (IF)
Application Notes
Suitable for use in Immunofluorescence, ELISA and Western Blot.
Dilution: Immunofluorescence: 10ug/ml
Dilution: Immunofluorescence: 10ug/ml
Immunogen
Recombinant corresponding to aa41-114 from human HES2 (NP_061962) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot detection against Immunogen (34.14kD), using MBS6000424.)
Western Blot (WB)
(Western Blot detection against Immunogen (34.14kD), using MBS6000424.)
Immunofluorescence (IF)
(Immunofluorescence of MBS6000424 (10ug/ml]) to HES2 on HeLa cells.)
Immunofluorescence (IF)
(Immunofluorescence of MBS6000424 (10ug/ml]) to HES2 on HeLa cells.)
Related Product Information for anti-HES2 antibody
Transcriptional repressor of genes that require a bHLH protein for their transcription.
Product Categories/Family for anti-HES2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
18,470 Da
NCBI Official Full Name
HES2 protein
NCBI Official Synonym Full Names
hairy and enhancer of split 2 (Drosophila)
NCBI Official Symbol
HES2
NCBI Official Synonym Symbols
bHLHb40
NCBI Protein Information
transcription factor HES-2; class B basic helix-loop-helix protein 40
UniProt Protein Name
Transcription factor HES-2
Protein Family
UniProt Gene Name
HES2
UniProt Synonym Gene Names
BHLHB40; bHLHb40
UniProt Entry Name
HES2_HUMAN
Uniprot Description
HES2: Transcriptional repressor of genes that require a bHLH protein for their transcription. 2 isoforms of the human protein are produced by alternative splicing.
Chromosomal Location of Human Ortholog: 1p36.31
Cellular Component: nucleus
Molecular Function: protein dimerization activity; double-stranded DNA binding; transcription factor binding
Biological Process: transcription, DNA-dependent; negative regulation of transcription, DNA-dependent
Similar Products
Product Notes
The HES2 hes2 (Catalog #AAA6000424) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The HES2 (Transcription Factor HES-2, Class B Basic Helix-loop-helix Protein 40, bHLHb40, Hairy and Enhancer of Split 2, BHLHB40) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's HES2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB), Immunofluorescence (IF). Suitable for use in Immunofluorescence, ELISA and Western Blot. Dilution: Immunofluorescence: 10ug/ml. Researchers should empirically determine the suitability of the HES2 hes2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: LPLLGRENSN CSKLEKADVL EMTVRFLQEL PASSWPTAAP LPCDSYREGY SACVARLARV LPACRVLEPA VSAR. It is sometimes possible for the material contained within the vial of "HES2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
