Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (DKK1 monoclonal antibody (M04), clone 3D9 Western Blot analysis of DKK1 expression in HeLa.)

Mouse DKK1 Monoclonal Antibody | anti-DKK1 antibody

DKK1 (Dickkopf Homolog 1 (Xenopus laevis), DKK-1, SK) (APC)

Gene Names
DKK1; SK; DKK-1
Applications
ELISA, Western Blot
Purity
Purified
Synonyms
DKK1; Monoclonal Antibody; DKK1 (Dickkopf Homolog 1 (Xenopus laevis); DKK-1; SK) (APC); Dickkopf Homolog 1 (Xenopus laevis); SK; anti-DKK1 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
3D9
Specificity
Recognizes DKK1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-DKK1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
DKK1 (NP_036374, 81aa-180aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
QPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYH
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(DKK1 monoclonal antibody (M04), clone 3D9 Western Blot analysis of DKK1 expression in HeLa.)

Western Blot (WB) (DKK1 monoclonal antibody (M04), clone 3D9 Western Blot analysis of DKK1 expression in HeLa.)
Related Product Information for anti-DKK1 antibody
This gene encodes a protein that is a member of the dickkopf family. It is a secreted protein with two cysteine rich regions and is involved in embryonic development through its inhibition of the WNT signaling pathway. Elevated levels of DKK1 in bone marrow plasma and peripheral blood is associated with the presence of osteolytic bone lesions in patients with multiple myeloma. [provided by RefSeq]
Product Categories/Family for anti-DKK1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
27.8kDa (253aa) 28-40kDa (SDS-PAGE under reducing conditions)
NCBI Official Full Name
dickkopf-related protein 1
NCBI Official Synonym Full Names
dickkopf WNT signaling pathway inhibitor 1
NCBI Official Symbol
DKK1
NCBI Official Synonym Symbols
SK; DKK-1
NCBI Protein Information
dickkopf-related protein 1
UniProt Protein Name
Dickkopf-related protein 1
Protein Family
UniProt Gene Name
DKK1
UniProt Synonym Gene Names
Dickkopf-1; Dkk-1; hDkk-1
UniProt Entry Name
DKK1_HUMAN

NCBI Description

This gene encodes a member of the dickkopf family of proteins. Members of this family are secreted proteins characterized by two cysteine-rich domains that mediate protein-protein interactions. The encoded protein binds to the LRP6 co-receptor and inhibits beta-catenin-dependent Wnt signaling. This gene plays a role in embryonic development and may be important in bone formation in adults. Elevated expression of this gene has been observed in numerous human cancers and this protein may promote proliferation, invasion and growth in cancer cell lines. [provided by RefSeq, Sep 2017]

Uniprot Description

DKK1: Antagonizes canonical Wnt signaling by inhibiting LRP5/6 interaction with Wnt and by forming a ternary complex with the transmembrane protein KREMEN that promotes internalization of LRP5/6. DKKs play an important role in vertebrate development, where they locally inhibit Wnt regulated processes such as antero- posterior axial patterning, limb development, somitogenesis and eye formation. In the adult, Dkks are implicated in bone formation and bone disease, cancer and Alzheimer disease. Interacts with LRP6. Interacts (via the C-termianl Cys- rich domain) with LRP5 (via beta-propeller regions 3 and 4); the interaction, enhanced by MESD and or KREMEN, antagonizes Wnt- mediated signaling. Placenta. Belongs to the dickkopf family.

Protein type: Secreted; Secreted, signal peptide; Inhibitor

Chromosomal Location of Human Ortholog: 10q11.2

Cellular Component: extracellular space; early endosome membrane; extracellular region; plasma membrane

Molecular Function: protein binding; receptor antagonist activity; signal transducer activity; growth factor activity; low-density lipoprotein receptor binding

Biological Process: cellular morphogenesis during differentiation; negative regulation of skeletal muscle development; response to retinoic acid; negative regulation of Wnt receptor signaling pathway; regulation of receptor internalization; negative regulation of peptidyl-serine phosphorylation; negative regulation of transcription from RNA polymerase II promoter; negative regulation of BMP signaling pathway; negative regulation of mesodermal cell fate specification; mesoderm formation; hair follicle development; endoderm formation; forebrain development; regulation of endodermal cell fate specification; negative regulation of protein complex assembly; embryonic limb morphogenesis

Research Articles on DKK1

Similar Products

Product Notes

The DKK1 dkk1 (Catalog #AAA6167920) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's DKK1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the DKK1 dkk1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "DKK1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.