Mouse HDAC3 Monoclonal Antibody | anti-HDAC3 antibody

HDAC3 (Histone Deacetylase 3, HD3, RPD3, RPD3-2) (HRP)

Cat. Num. AAA6179452

• Gene Names: HDAC3; HD3; RPD3; KDAC3; RPD3-2
• Applications: Immunofluorescence, Immunoprecipitation
• Purity: Purified
• Synonyms: HDAC3; Monoclonal Antibody; HDAC3 (Histone Deacetylase 3; HD3; RPD3; RPD3-2) (HRP); Histone Deacetylase 3; RPD3-2; anti-HDAC3 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 2F9-4B7
• Specificity: Recognizes HDAC3.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
• Sequence Length: 428

• Applicable Applications for anti-HDAC3 antibody: Immunofluorescence (IF), Immunoprecipitation (IP)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: HDAC3 (AAH00614, 1aa-428aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MAKTVAYFYDPDVGNFHYGAGHPMKPHRLALTHSLVLHYGLYKKMIVFKPYQASQHDMCRFHSEDYIDFLQRVSPTNMQGFTKSLNAFNVGDDCPVFPGLFEFCSRYTGASLQGATQLNNKICDIAINWAGGLHHAKKFEASGFCYVNDIVIGILELLKYHPRVLYIDIDIHHGDGVQEAFYLTDRVMTVSFHKYGNYFFPGTGDMYEVGAESGRYYCLNVPLRDGIDDQSYKHLFQPVINQVVDFYQPTCIVLQCGADSLGCDRLGCFNLSIRGHGECVEYVKSFNIPLLVLGGGGYTVRNVARCWTYETSLLVEEAISEELPYSEYFEYFAPDFTLHPDVSTRIENQNSRQYLDQIRQTIFENLKMLNHAPSVQIHDVPADLLTYDRTDEADAEERGPEENYSRPEAPNEFYDGDHDNDKESDVEI
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged HDAC3 is 1 ng/ml as a capture antibody.)

Immunoprecipitation (IP)

(Immunoprecipitation of HDAC3 transfected lysate using anti-HDAC3 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with HDAC3 MaxPab rabbit polyclonal antibody.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to HDAC3 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to HDAC3 on HeLa cell. [antibody concentration 10 ug/ml])

Product Categories/Family for anti-HDAC3 antibody

Antibodies; Enzymes; Deacetylase

NCBI and Uniprot Product Information

• NCBI GI #: 12653663
• NCBI GeneID: 8841
• NCBI Official Full Name: Histone deacetylase 3
• NCBI Official Synonym Full Names: histone deacetylase 3
• NCBI Official Symbol: HDAC3
• NCBI Official Synonym Symbols: HD3; RPD3; KDAC3; RPD3-2
• NCBI Protein Information: histone deacetylase 3
• Protein Family: Histone deacetylase

NCBI Description

Histones play a critical role in transcriptional regulation, cell cycle progression, and developmental events. Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to DNA. The protein encoded by this gene belongs to the histone deacetylase/acuc/apha family. It has histone deacetylase activity and represses transcription when tethered to a promoter. It may participate in the regulation of transcription through its binding with the zinc-finger transcription factor YY1. This protein can also down-regulate p53 function and thus modulate cell growth and apoptosis. This gene is regarded as a potential tumor suppressor gene. [provided by RefSeq, Jul 2008]