Mouse anti-Human HARS Monoclonal Antibody | anti-HARS antibody

HARS (HRS, Histidine-tRNA Ligase, Cytoplasmic, Histidyl-tRNA Synthetase, FLJ20491) (Biotin)

Cat. Num. AAA6142225

• Gene Names: HARS; HRS; CMT2W; USH3B
• Reactivity: Human
• Applications: ELISA, Immunofluorescence, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: HARS; Monoclonal Antibody; HARS (HRS; Histidine-tRNA Ligase; Cytoplasmic; Histidyl-tRNA Synthetase; FLJ20491) (Biotin); anti-HARS antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 1C8
• Specificity: Recognizes human HARS.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-HARS antibody: ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
• Application Notes: IF: 10ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa1-96 from human HARS (NP_002100) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MAERAALEELVKLQGERVRGLKQQKASAELIEEEVAKLLKLKAQLGPDESKQKFVLKTPKGTRDYSPRQMAVREKVFDVIIRCFKRHGAEVIDTPV
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.3kD).)

Western Blot (WB)

(HARS monoclonal antibody Western Blot analysis of HARS expression in HeLa.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to HARS on HeLa cell. [antibody concentration 10ug/ml])

Testing Data

(Detection limit for recombinant GST tagged HARS is ~0.03ng/ml as a capture antibody.)

Product Categories/Family for anti-HARS antibody

Antibodies; Enzymes; Synthase

NCBI and Uniprot Product Information

• NCBI GI #: 6996014
• NCBI GeneID: 3035
• NCBI Accession #: NP_002100
• NCBI GenBank Nucleotide #: NM_002109
• UniProt Accession #: P12081; B4DHQ1; B4DY73; D6REN6; J3KNE5
• Molecular Weight: 59.4 kDa (532aa), confirmed by MALDI-TOF
• NCBI Official Full Name: histidine--tRNA ligase, cytoplasmic isoform 1
• NCBI Official Synonym Full Names: histidyl-tRNA synthetase
• NCBI Official Symbol: HARS
• NCBI Official Synonym Symbols: HRS; CMT2W; USH3B
• NCBI Protein Information: histidine--tRNA ligase, cytoplasmic
• UniProt Protein Name: Histidine--tRNA ligase, cytoplasmic
• Protein Family: Histidine--tRNA ligase
• UniProt Gene Name: HARS
• UniProt Synonym Gene Names: HRS; HisRS
• UniProt Entry Name: SYHC_HUMAN

NCBI Description

Aminoacyl-tRNA synthetases are a class of enzymes that charge tRNAs with their cognate amino acids. The protein encoded by this gene is a cytoplasmic enzyme which belongs to the class II family of aminoacyl-tRNA synthetases. The enzyme is responsible for the synthesis of histidyl-transfer RNA, which is essential for the incorporation of histidine into proteins. The gene is located in a head-to-head orientation with HARSL on chromosome five, where the homologous genes share a bidirectional promoter. The gene product is a frequent target of autoantibodies in the human autoimmune disease polymyositis/dermatomyositis. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Apr 2012]

Uniprot Description

HARS: Defects in HARS are a cause of Usher syndrome type 3B (USH3B). USH3B is a syndrome characterized by progressive vision and hearing loss during early childhood. Some patients have the so-called 'Charles Bonnet syndrome,' involving decreased visual acuity and vivid visual hallucinations. USH is a genetically heterogeneous condition characterized by the association of retinitis pigmentosa with sensorineural deafness. Age at onset and differences in auditory and vestibular function distinguish Usher syndrome type 1 (USH1), Usher syndrome type 2 (USH2) and Usher syndrome type 3 (USH3). USH3 is characterized by postlingual, progressive hearing loss, variable vestibular dysfunction, and onset of retinitis pigmentosa symptoms, including nyctalopia, constriction of the visual fields, and loss of central visual acuity, usually by the second decade of life. Belongs to the class-II aminoacyl-tRNA synthetase family.

Protein type: Translation; EC 6.1.1.21; Ligase

Chromosomal Location of Human Ortholog: 5q31.3

Cellular Component: cytoplasm; cytosol

Molecular Function: histidine-tRNA ligase activity; ATP binding

Biological Process: tRNA aminoacylation for protein translation; translation; gene expression; histidyl-tRNA aminoacylation

Disease: Usher Syndrome, Type Iiib