Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.66kD).)

Mouse anti-Human, Mouse HAPLN4 Monoclonal Antibody | anti-HAPLN4 antibody

HAPLN4 (BRAL2, KIAA1926, Hyaluronan and Proteoglycan Link Protein 4, Brain Link Protein 2) (Biotin)

Gene Names
HAPLN4; BRAL2
Reactivity
Human, Mouse
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
HAPLN4; Monoclonal Antibody; HAPLN4 (BRAL2; KIAA1926; Hyaluronan and Proteoglycan Link Protein 4; Brain Link Protein 2) (Biotin); anti-HAPLN4 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse
Clonality
Monoclonal
Isotype
IgG3,k
Clone Number
1G5
Specificity
Recognizes human HAPLN4. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-HAPLN4 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Sandwich ELISA: The detection limit is ~0.3ng/ml as a capture antibody.
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa30-135 from human HAPLN4 (NP_075378) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
QRGRKKVVHVLEGESGSVVVQTAPGQVVSHRGGTIVLPCRYHYEAAAHGHDGVRLKWTKVVDPLAFTDVFVALGPQHRAFGSYRGRAELQGDGPGDASLVLRNVT*
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.66kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.66kD).)

Western Blot (WB)

(HAPLN4 monoclonal antibody. Western Blot analysis of HAPLN4 expression in Raw 264.7.)

Western Blot (WB) (HAPLN4 monoclonal antibody. Western Blot analysis of HAPLN4 expression in Raw 264.7.)

Testing Data

(Detection limit for recombinant GST tagged HAPLN4 is 0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged HAPLN4 is 0.3ng/ml as a capture antibody.)
Product Categories/Family for anti-HAPLN4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43kDa
NCBI Official Full Name
hyaluronan and proteoglycan link protein 4
NCBI Official Synonym Full Names
hyaluronan and proteoglycan link protein 4
NCBI Official Symbol
HAPLN4
NCBI Official Synonym Symbols
BRAL2
NCBI Protein Information
hyaluronan and proteoglycan link protein 4
UniProt Protein Name
Hyaluronan and proteoglycan link protein 4
UniProt Gene Name
HAPLN4
UniProt Synonym Gene Names
BRAL2; KIAA1926
UniProt Entry Name
HPLN4_HUMAN

Uniprot Description

HAPLN4: Binds to hyaluronic acid and may be involved in formation of the extracellular matrix. Belongs to the HAPLN family.

Protein type: Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 19p13.1

Cellular Component: proteinaceous extracellular matrix

Molecular Function: extracellular matrix structural constituent; hyaluronic acid binding

Biological Process: central nervous system development; cell adhesion; skeletal development

Research Articles on HAPLN4

Similar Products

Product Notes

The HAPLN4 hapln4 (Catalog #AAA6142224) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The HAPLN4 (BRAL2, KIAA1926, Hyaluronan and Proteoglycan Link Protein 4, Brain Link Protein 2) (Biotin) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's HAPLN4 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Sandwich ELISA: The detection limit is ~0.3ng/ml as a capture antibody. Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the HAPLN4 hapln4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HAPLN4, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.