Western Blot (WB)
(Western Blot detection against Immunogen (37.66kD).)
Mouse anti-Human, Mouse HAPLN4 Monoclonal Antibody | anti-HAPLN4 antibody
HAPLN4 (BRAL2, KIAA1926, Hyaluronan and Proteoglycan Link Protein 4, Brain Link Protein 2)
Gene Names
HAPLN4; BRAL2
Reactivity
Human, Mouse
Applications
ELISA, Western Blot
Purity
Affinity PurifiedPurified by Protein A affinity chromatography.
Synonyms
HAPLN4; Monoclonal Antibody; HAPLN4 (BRAL2; KIAA1926; Hyaluronan and Proteoglycan Link Protein 4; Brain Link Protein 2); Anti -HAPLN4 (BRAL2; anti-HAPLN4 antibody
Host
Mouse
Reactivity
Human, Mouse
Clonality
Monoclonal
Isotype
IgG3,k
Clone Number
1G5
Specificity
Recognizes human HAPLN4. Species Crossreactivity: mouse.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
QRGRKKVVHVLEGESGSVVVQTAPGQVVSHRGGTIVLPCRYHYEAAAHGHDGVRLKWTKVVDPLAFTDVFVALGPQHRAFGSYRGRAELQGDGPGDASLVLRNVT*
Applicable Applications for anti-HAPLN4 antibody
ELISA (EL/EIA), Western Blot (WB)
Application Notes
Suitable for use in ELISA and Western Blot.
Dilution: Sandwich ELISA: The detection limit is ~0.3ng/ml as a capture antibody.
Dilution: Sandwich ELISA: The detection limit is ~0.3ng/ml as a capture antibody.
Immunogen
Partial recombinant protein corresponding to aa30-135 from human HAPLN4 (NP_075378) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot detection against Immunogen (37.66kD).)
Western Blot (WB)
(Western Blot detection against Immunogen (37.66kD).)
Western Blot (WB)
(HAPLN4 monoclonal antibody. Western Blot analysis of HAPLN4 expression in Raw 264.7.)
Western Blot (WB)
(HAPLN4 monoclonal antibody. Western Blot analysis of HAPLN4 expression in Raw 264.7.)
Testing Data
(Detection limit for recombinant GST tagged HAPLN4 is 0.3ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged HAPLN4 is 0.3ng/ml as a capture antibody.)
Related Product Information for anti-HAPLN4 antibody
HAPLN4 binds to hyaluronic acid and may be involved in formation of the extracellular matrix (By similarity).
Product Categories/Family for anti-HAPLN4 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
42,801 Da
NCBI Official Full Name
hyaluronan and proteoglycan link protein 4
NCBI Official Synonym Full Names
hyaluronan and proteoglycan link protein 4
NCBI Official Symbol
HAPLN4
NCBI Official Synonym Symbols
BRAL2
NCBI Protein Information
hyaluronan and proteoglycan link protein 4; brain link protein 2
UniProt Protein Name
Hyaluronan and proteoglycan link protein 4
Protein Family
UniProt Gene Name
HAPLN4
UniProt Synonym Gene Names
BRAL2; KIAA1926
UniProt Entry Name
HPLN4_HUMAN
Uniprot Description
Function: Binds to hyaluronic acid and may be involved in formation of the extracellular matrix
By similarity.
Subcellular location: Secreted › extracellular space › extracellular matrix
By similarity.
Tissue specificity: Expressed predominantly in brain. Ref.1
Sequence similarities: Belongs to the HAPLN family.Contains 1 Ig-like C2-type (immunoglobulin-like) domain.Contains 2 Link domains.
Sequence caution: The sequence BAB67819.1 differs from that shown. Reason: Erroneous initiation.
Research Articles on HAPLN4
Similar Products
Product Notes
The HAPLN4 hapln4 (Catalog #AAA649141) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The HAPLN4 (BRAL2, KIAA1926, Hyaluronan and Proteoglycan Link Protein 4, Brain Link Protein 2) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's HAPLN4 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Suitable for use in ELISA and Western Blot. Dilution: Sandwich ELISA: The detection limit is ~0.3ng/ml as a capture antibody. Researchers should empirically determine the suitability of the HAPLN4 hapln4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: QRGRKKVVHV LEGESGSVVV QTAPGQVVSH RGGTIVLPCR YHYEAAAHGH DGVRLKWTKV VDPLAFTDVF VALGPQHRAF GSYRGRAELQ GDGPGDASLV LRNVT*. It is sometimes possible for the material contained within the vial of "HAPLN4, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
