Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (34.1kD).)

Mouse anti-Human GTPBP1 Monoclonal Antibody | anti-GTPBP1 antibody

GTPBP1 (GTP-binding Protein 1, G-protein 1, GP-1, GP1) (AP)

Gene Names
GTPBP1; GP1; GP-1; HSPC018
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
GTPBP1; Monoclonal Antibody; GTPBP1 (GTP-binding Protein 1; G-protein 1; GP-1; GP1) (AP); anti-GTPBP1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1H1
Specificity
Recognizes human GTPBP1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Sequence Length
4905
Applicable Applications for anti-GTPBP1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-76 from GTPBP1 (NP_004277) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MDEGCGETIYVIGQGSDGTEYGLSEADMEASYATVKSMAEQIEADVILLRERQEAGGRVRDYLVRKRVGDNDFLEV
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (34.1kD).)

Western Blot (WB) (Western Blot detection against Immunogen (34.1kD).)

Western Blot (WB)

(Western Blot analysis of GTPBP1 expression in transfected 293T cell line by GTPBP1 monoclonal antibody Lane 1: GTPBP1 transfected lysate (63.4kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of GTPBP1 expression in transfected 293T cell line by GTPBP1 monoclonal antibody Lane 1: GTPBP1 transfected lysate (63.4kD). Lane 2: Non-transfected lysate.)

Immunoprecipitation (IP)

(Immunoprecipitation of GTPBP1 transfected lysate using GTPBP1 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with GTPBP1 monoclonal antibody.)

Immunoprecipitation (IP) (Immunoprecipitation of GTPBP1 transfected lysate using GTPBP1 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with GTPBP1 monoclonal antibody.)
Related Product Information for anti-GTPBP1 antibody
This gene is upregulated by interferon-gamma and encodes a protein that is a member of the AGP11/GTPBP1 family of GTP-binding proteins. A structurally similar protein has been found in mouse, where disruption of the gene for that protein had no observable phenotype.
Product Categories/Family for anti-GTPBP1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens GTP binding protein 1 (GTPBP1), mRNA
NCBI Official Synonym Full Names
GTP binding protein 1
NCBI Official Symbol
GTPBP1
NCBI Official Synonym Symbols
GP1; GP-1; HSPC018
NCBI Protein Information
GTP-binding protein 1
UniProt Protein Name
GTP-binding protein 1
Protein Family
UniProt Gene Name
GTPBP1
UniProt Synonym Gene Names
G-protein 1; GP-1; GP1
UniProt Entry Name
GTPB1_HUMAN

NCBI Description

This gene is upregulated by interferon-gamma and encodes a protein that is a member of the AGP11/GTPBP1 family of GTP-binding proteins. A structurally similar protein has been found in mouse, where disruption of the gene for that protein had no observable phenotype. [provided by RefSeq, Jul 2008]

Uniprot Description

GTPBP1: Promotes degradation of target mRNA species. Plays a role in the regulation of circadian mRNA stability. Binds GTP and has GTPase activity. Belongs to the GTPBP1 GTP-binding protein family.

Protein type: Hydrolase

Chromosomal Location of Human Ortholog: 22q13.1

Cellular Component: membrane; cytosol

Molecular Function: GTPase activity; GTP binding

Biological Process: metabolic process; immune response; signal transduction

Research Articles on GTPBP1

Similar Products

Product Notes

The GTPBP1 gtpbp1 (Catalog #AAA6131598) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The GTPBP1 (GTP-binding Protein 1, G-protein 1, GP-1, GP1) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GTPBP1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the GTPBP1 gtpbp1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GTPBP1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.