Mouse anti-Human GTF2A2 Monoclonal Antibody | anti-GTF2A2 antibody

GTF2A2 (Transcription Initiation Factor IIA Subunit 2, General Transcription Factor IIA Subunit 2, TFIIA p12 Subunit, TFIIA-12, TFIIAS, Transcription Initiation Factor IIA gamma Chain, TFIIA-gamma, TF2A2) APC

Cat. Num. AAA6136892

• Gene Names: GTF2A2; TF2A2; TFIIA; T18745; TFIIAS; HsT18745; TFIIA-12; TFIIA-gamma
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: GTF2A2; Monoclonal Antibody; GTF2A2 (Transcription Initiation Factor IIA Subunit 2; General Transcription Factor IIA Subunit 2; TFIIA p12 Subunit; TFIIA-12; TFIIAS; Transcription Initiation Factor IIA gamma Chain; TFIIA-gamma; TF2A2) APC; anti-GTF2A2 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 2B9
• Specificity: Recognizes human GTF2A2.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).

• Applicable Applications for anti-GTF2A2 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant corresponding to aa1-109 from human GTF2A2 (AAH00287) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MAYQLYRNTTLGNSLQESLDELIQSQQITPQLALQVLLQFDKAINAALAQRVRNRVNFRGSLNTYRFCDNVWTFVLNDVEFREVTELIKVDKVKIVACDGKNTGSNTTE
• Conjugate: APC
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.73kD).)

Western Blot (WB)

(Western Blot analysis of GTF2A2 expression in transfected 293T cell line by GTF2A2 monoclonal antibody. Lane 1: GTF2A2 transfected lysate (12.5kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged GTF2A2 is ~0.3ng/ml as a capture antibody.)

Related Product Information for anti-GTF2A2 antibody

TFIIA is a component of the transcription machinery of RNA polymerase II and plays an important role in transcriptional activation. TFIIA in a complex with TBP mediates transcriptional activity.

Product Categories/Family for anti-GTF2A2 antibody

Antibodies; Translation Initiation Factors

NCBI and Uniprot Product Information

• NCBI GI #: 33875256
• NCBI GeneID: 2958
• Molecular Weight: 12,457 Da
• NCBI Official Full Name: Homo sapiens general transcription factor IIA, 2, 12kDa, mRNA
• NCBI Official Synonym Full Names: general transcription factor IIA subunit 2
• NCBI Official Symbol: GTF2A2
• NCBI Official Synonym Symbols: TF2A2; TFIIA; T18745; TFIIAS; HsT18745; TFIIA-12; TFIIA-gamma
• NCBI Protein Information: transcription initiation factor IIA subunit 2

NCBI Description

Accurate transcription initiation on TATA-containing class II genes involves the ordered assembly of RNA polymerase II (POLR2A; MIM 180660) and the general initiation factors TFIIA, TFIIB (MIM 189963), TFIID (MIM 313650), TFIIE (MIM 189962), TFIIF (MIM 189968), TFIIG/TFIIJ, and TFIIH (MIM 189972). The first step involves recognition of the TATA element by the TATA-binding subunit (TBP; MIM 600075) and may be regulated by TFIIA, a factor that interacts with both TBP and a TBP-associated factor (TAF; MIM 600475) in TFIID. TFIIA has 2 subunits (43 and 12 kD) in yeast and 3 subunits in higher eukaryotes. In HeLa extracts, it consists of a 35-kD alpha subunit and a 19-kD beta subunit encoded by the N- and C-terminal regions of GTF2A1 (MIM 600520), respectively, and a 12-kD gamma subunit encoded by GTF2A2 (DeJong et al., 1995 [PubMed 7724559]).[supplied by OMIM, Mar 2008]