Mouse anti-Human, Mouse GSTM2 Monoclonal Antibody | anti-GSTM2 antibody

GSTM2 (Glutathione S-transferase Mu 2, GST Class-mu 2, GSTM2-2, GST4, MGC117303) (HRP)

Cat. Num. AAA6152792

• Gene Names: GSTM2; GST4; GSTM; GTHMUS; GSTM2-2
• Reactivity: Human, Mouse
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: GSTM2; Monoclonal Antibody; GSTM2 (Glutathione S-transferase Mu 2; GST Class-mu 2; GSTM2-2; GST4; MGC117303) (HRP); anti-GSTM2 antibody

• Host: Mouse
• Reactivity: Human, Mouse
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 1E10
• Specificity: Recognizes human GSTM2. Species Crossreactivity: mouse.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-GSTM2 antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
• Application Notes: IHC-P: 3ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa90-189 from human GSTM2 (NP_000839) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: SEKEQIREDILENQFMDSRMQLAKLCYDPDFEKLKPEYLQALPEMLKLYSQFLGKQPWFLGDKITFVDFIAYDVLERNQVFEPSCLDAFPNLKDFISRFE
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB)

(GSTM2 monoclonal antibody. Western Blot analysis of GSTM2 expression in NIH/3T3.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to GSTM2 on formalin-fixed paraffin-embedded human breast cancer. [antibody concentration 3ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged GSTM2 is 0.03ng/ml as a capture antibody.)

Product Categories/Family for anti-GSTM2 antibody

Antibodies; GST

NCBI and Uniprot Product Information

• NCBI GI #: 4504175
• NCBI GeneID: 2946
• NCBI Accession #: NP_000839
• NCBI GenBank Nucleotide #: NM_000848
• UniProt Accession #: P28161; Q2M318; Q5TZY5; Q8WWE1; B4DRY4; E9PEM9
• Molecular Weight: 27.9 kDa (238aa), confirmed by MALDI-TOF
• NCBI Official Full Name: glutathione S-transferase Mu 2 isoform 1
• NCBI Official Synonym Full Names: glutathione S-transferase mu 2
• NCBI Official Symbol: GSTM2
• NCBI Official Synonym Symbols: GST4; GSTM; GTHMUS; GSTM2-2
• NCBI Protein Information: glutathione S-transferase Mu 2
• UniProt Protein Name: Glutathione S-transferase Mu 2
• Protein Family: Glutathione S-transferase
• UniProt Gene Name: GSTM2
• UniProt Synonym Gene Names: GST4
• UniProt Entry Name: GSTM2_HUMAN

NCBI Description

Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-transferase that belongs to the mu class. The mu class of enzymes functions in the detoxification of electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress, by conjugation with glutathione. The genes encoding the mu class of enzymes are organized in a gene cluster on chromosome 1p13.3 and are known to be highly polymorphic. These genetic variations can change an individual's susceptibility to carcinogens and toxins as well as affect the toxicity and efficacy of certain drugs. [provided by RefSeq, Jul 2008]

Uniprot Description

GSTM2: Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. Belongs to the GST superfamily. Mu family.

Protein type: Transferase; Motility/polarity/chemotaxis; EC 2.5.1.18

Chromosomal Location of Human Ortholog: 1p13.3

Cellular Component: sarcoplasmic reticulum; cytoplasm; cytosol

Molecular Function: protein homodimerization activity; enzyme binding; glutathione transferase activity; glutathione binding; receptor binding

Biological Process: regulation of skeletal muscle contraction via regulation of the release of sequestered calcium ion; glutathione metabolic process; nitrobenzene metabolic process; xenobiotic metabolic process; xenobiotic catabolic process