Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to MKRN3 on HeLa cell. [antibody concentration 10ug/ml])

Mouse anti-Human MKRN3 Monoclonal Antibody | anti-MKRN3 antibody

MKRN3 (D15S9, RNF63, ZNF127, Probable E3 Ubiquitin-protein Ligase Makorin-3, RING Finger Protein 63, Zinc Finger Protein 127, MGC88288) APC

Gene Names
MKRN3; CPPB2; D15S9; RNF63; ZFP127; ZNF127
Reactivity
Human
Applications
ELISA, Immunofluorescence
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
MKRN3; Monoclonal Antibody; MKRN3 (D15S9; RNF63; ZNF127; Probable E3 Ubiquitin-protein Ligase Makorin-3; RING Finger Protein 63; Zinc Finger Protein 127; MGC88288) APC; anti-MKRN3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
2E10
Specificity
Recognizes human MKRN3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-MKRN3 antibody
ELISA (EIA), Immunofluorescence (IF)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa437-508 from human MKRN3 (NP_005655) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SFSAYWHQLVEPVRMGEGNMLYKSIKKELVVLRLASLLFKRFLSLRDELPFSEDQWDLLHYELEEYFNLIL*
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to MKRN3 on HeLa cell. [antibody concentration 10ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to MKRN3 on HeLa cell. [antibody concentration 10ug/ml])
Product Categories/Family for anti-MKRN3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Predicted: 55 kDa

Observed: 55 kDa
NCBI Official Full Name
probable E3 ubiquitin-protein ligase makorin-3
NCBI Official Synonym Full Names
makorin ring finger protein 3
NCBI Official Symbol
MKRN3
NCBI Official Synonym Symbols
CPPB2; D15S9; RNF63; ZFP127; ZNF127
NCBI Protein Information
probable E3 ubiquitin-protein ligase makorin-3; RING finger protein 63; zinc finger protein 127
UniProt Protein Name
Probable E3 ubiquitin-protein ligase makorin-3
UniProt Gene Name
MKRN3
UniProt Synonym Gene Names
D15S9; RNF63; ZNF127
UniProt Entry Name
MKRN3_HUMAN

NCBI Description

The protein encoded by this gene contains a RING (C3HC4) zinc finger motif and several C3H zinc finger motifs. This gene is intronless and imprinted, with expression only from the paternal allele. Disruption of the imprinting at this locus may contribute to Prader-Willi syndrome. An antisense RNA of unknown function has been found overlapping this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

MKRN3: E3 ubiquitin ligase catalyzing the covalent attachment of ubiquitin moieties onto substrate proteins.

Protein type: Ubiquitin conjugating system; EC 6.3.2.19; EC 6.3.2.-; Ubiquitin ligase

Chromosomal Location of Human Ortholog: 15q11-q13

Cellular Component: ribonucleoprotein complex

Molecular Function: protein binding; zinc ion binding; ligase activity

Biological Process: protein ubiquitination

Disease: Prader-willi Syndrome; Precocious Puberty, Central, 2

Research Articles on MKRN3

Similar Products

Product Notes

The MKRN3 mkrn3 (Catalog #AAA6137634) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The MKRN3 (D15S9, RNF63, ZNF127, Probable E3 Ubiquitin-protein Ligase Makorin-3, RING Finger Protein 63, Zinc Finger Protein 127, MGC88288) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MKRN3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MKRN3 mkrn3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MKRN3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.